KEGG   Burkholderia cepacia: GEM_5549Help
Entry
GEM_5549          CDS       T02205                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bct  Burkholderia cepacia
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bct00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bct00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2608981..2609766
Genome map
AA seq 261 aa AA seqDB search
MSNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGANAVADEINKAGGKAIGV
AMDVTNEEAVNSGIDKVAEAFGSVDILVSNAGIQIVNPIENYAFSDWKKMQAIHVDGAFL
TTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGNTVDGVFTTVQDVAQTVLFLS
AFPSAALTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctgaatggcaagaccgcagtcgtcacgggcgccgcaagcggcatcggcaag
gaaatcgcactcgagctcgccaaggcgggcgcggccgtcgcgatcgccgacctgaaccag
gacggcgcgaatgcggttgccgacgagatcaacaaggcaggcggcaaggcgatcggcgtc
gcgatggacgtgaccaacgaggaagccgtgaacagcggcatcgacaaggtggccgaggcg
ttcggctcggtcgacatcctcgtgtcgaacgcgggcatccagatcgtcaacccgatcgag
aactacgcgttctccgactggaagaagatgcaggcgatccacgtcgacggcgcgttcctg
acgaccaaggccgcgctcaagcacatgtacaaggacgatcgcggcggcgtcgtgatctac
atgggttcggtgcactcgcacgaagcgtcgccgctgaagtcggcgtacgtgacggccaag
cacgggctgctcggcctggcccgcgtgctggcgaaggaaggcgcaaagcacaacgtgcgc
tcgcacgtcgtgtgtccgggcttcgtgcgcacgccgctggtcgacaagcagattccggag
caggcgaaggaactcggcatcagcgaagaagaagtggtgaagaaggtgatgctcggcaat
acggtcgacggcgtgttcacgacggtgcaggacgtcgcgcagacggtgctgttcctgtcg
gcattcccgagcgccgcgctcaccggccagtcgttcgtcgtcagccacggctggttcatg
cagtaa

DBGET integrated database retrieval system