KEGG   Burkholderia cepacia GG4: GEM_5590Help
Entry
GEM_5590          CDS       T02205                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bct  Burkholderia cepacia GG4
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GEM_5590
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GEM_5590
   00630 Glyoxylate and dicarboxylate metabolism
    GEM_5590
Enzymes [BR:bct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GEM_5590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2654381..2656555)
Genome map
AA seq 724 aa AA seqDB search
MIDQAGLQVAPALSQFIENEALPGTGIDTAAFWSGFSALVHDLAPRNRALLAERDRLQQE
LDGWHRAHPGPVRDHAAYRAFLEQIGYLVPVPSNVAAATANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDGGAERTSAYNPTRGQRVIDYARNVLDNAAPLA
SGSHRDALRYRVQDGQLAVETGKGVTHLAQPAQFVGYQGAADAPSAILLQHNGLHLEIQI
DASTPIGRADLANVKDVVLEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMQGTLVEEV
AKGGKTFTRRLNADREYTTPAGGTLSLHGRSLLFVRNVGHLMTNGAVLDRDGNEIPEGIL
DGVVTTLCSLHDLQAKRNSRTGSIYIVKPKMHGPVEVAFADTLFARIEDLYNLPRNTLKM
GIMDEERRTSVNLAACIAAAATRVAFINTGFLDRTGDEMHTAMEAGPMIRKGDMKSSAWI
QSYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHLVDVQAVQQELEKTPYASERDALLEGLLTVPVVERAAWSESEILSEVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPGYDQSTAFKAACALALQGTSQPSGYTEPLLHQFRLAFKAQ
QHGG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccaagcaggactgcaagtcgcaccagcgctgagccagttcattgaaaacgaa
gcactgccgggcaccggcatcgacacagccgcgttctggagcggtttctcggccctggtg
cacgacctcgcgccgcgcaaccgcgcgttgctcgcggaacgcgaccgcctgcagcaggaa
ctcgacgggtggcatcgcgcgcaccccggcccggtgcgcgaccacgccgcgtatcgcgca
ttcctcgaacagatcggctacctcgtgccggtcccgtcgaacgtcgcggcagccaccgcg
aacgtcgacagcgagatcgcgacgcaagccggcccgcagctcgtcgtgccgctgtcgaac
gcgcgctatgcgctgaacgccgcgaacgcgcgctggggcagcctgtacgatgcgctgtac
ggcaccgacgcactgcccgaggacggcggcgccgaacgcacgtcggcctacaacccgacg
cgcggccagcgcgtgatcgactacgcgcgcaacgtgctcgacaacgcggcgccgctcgcg
agcggctcgcaccgcgacgcgctgcgctaccgcgtacaggacggccagctcgccgtcgaa
accggcaagggcgtcacgcacctcgcgcagccggcgcaattcgtcggctatcagggcgcg
gccgacgcgccgtccgcgatcctgctgcagcacaacggcctgcacctcgagatccagatc
gacgcgtcgacccccatcggtcgcgccgatctcgcgaacgtgaaggacgtcgtgctcgaa
gccgcggtcagcacgatcatcgactgcgaggattcggtcgcggcggtcgacgccgatgac
aaggtccagctctaccgcaactggctcggcctgatgcagggcacgctggtcgaggaagtc
gcgaagggcggcaagaccttcacgcgccgcctgaacgccgatcgcgagtacacgacgccg
gccggcggcacgctgtcgctgcacggccgctcgctgctgttcgtgcgcaacgtcggccac
ctgatgaccaacggcgcggtgctcgaccgcgacggcaacgagattccggaagggatcctc
gacggcgtcgtcacgacgctgtgctcgctgcacgacctgcaggccaagcgcaactcgcgc
accggctcgatctacattgtgaagccgaagatgcacggcccggtcgaagtcgcgttcgcc
gacacgctgttcgcgcgcatcgaggacctgtacaacctgccgcgcaacacgctgaagatg
ggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcgtgcatcgcagccgcc
gccacgcgcgtcgcgttcatcaacaccggcttcctcgaccgcaccggcgacgagatgcac
accgcgatggaagcgggcccgatgatccgcaagggcgacatgaagtcgtcggcgtggatc
cagtcgtacgagcgcaacaacgtgctcgcgggcctgtcggccggcctgcgcggccgcgcg
cagatcggcaagggcatgtgggcgatgccggacctgatgcacgcgatgctcgagcagaag
atcgcgcatccgcgcgccggcgcgaacaccgcatgggtgccgtcgccgaccgccgcgacg
ctgcacgcgctgcactaccacctcgtcgacgtgcaggccgtccagcaggagctcgagaag
acgccgtacgcgagcgaacgcgacgcgctgctcgaagggctgctgaccgtgccggtcgtc
gagcgcgccgcctggagcgagagcgagatcctgagcgaggtcgagaacaacgcacaaggc
atcctcggctacgtcgtgcgctgggtcgaacagggcgtcggctgctcgaaggtgcccgac
atccacgacgtcggcctgatggaagaccgcgcgacgctgcgcatctcgagccagcacatc
gcgaactggctgcgccacggcgtgatcaccgaggcgttcgtgctcgacgtgttcaagcgg
atggcgcgcgtcgtcgaccagcagaacgcgggcgacccgaactatcgtccgatggcgccc
ggctacgaccagtcgaccgcgttcaaggccgcgtgcgcactcgcgctgcagggcacgtcg
cagccgagcggctataccgagccgctgctgcatcagttccggctcgcgttcaaggcgcaa
cagcacggcggttga

DBGET integrated database retrieval system