KEGG   Bacillus cereus AH820: BCAH820_0025Help
Entry
BCAH820_0025      CDS       T00814                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bcu  Bacillus cereus AH820
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCAH820_0025 (recR)
DNA repair and recombination proteins [BR:bcu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BCAH820_0025 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27571..28167
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMEGIGPE
DINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccaatatcaaaactaattgatagttttatgaaattgccaggaatc
ggaccgaaaacagcggttcgattggcatttttcgtattagatatgaaagaagatgatgtg
ttaggttttgcaaaagcacttgtaaatgcaaagcgagacttagcgtattgttccgtatgt
gggcatattactgaccgtgacccttgttatatttgtaacgattcacatcgagatcaatca
gtggtttgtgtcgtacaagaaccgaaagatgtaatcgcgatggaaaagatgaaagagtat
caaggtgtatatcatgtgttacgtggtgctatctctccaatggagggaattggaccagaa
gacattaatatcccgcagcttttaaagcgactgcacgatgaaacggtacaagaagtaata
ttagcaacaaatcctaatattgaaggggaagctacagcgatgtatatatcccgcctctta
aagccgacaggtattaaagtaactcgtattgcacatggtctgccagttggtggagattta
gaatatgcagatgaagtgacactgtcgaaagcgttagaaggtcgtagagaagtataa

DBGET integrated database retrieval system