KEGG   Bacillus cereus AH820: BCAH820_0734Help
Entry
BCAH820_0734      CDS       T00814                                 

Definition
hypothetical protein
Organism
bcu  Bacillus cereus AH820
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
711210..712382
Genome map
AA seq 390 aa AA seqDB search
MDRGIFKEVPLPCAFLDEVALDRNIQSIIELSGNKKIRIASKSLRSVPVMQRILAASDRF
QGIMCFSPREALFLIEQGFNDLLLGYPAYDERALHEISLLTKQGLIITCMVDCEDHIVYL
EKIAEKSKGCFRVCLDIDMSSRFFKFHFGVKRSPVKDGQGALKIVKRLKESSFLILDGVM
GYEAQIAGVGDHIPNQRVKSKVISYLKKKSVLEVKERRGHILKEIQNLGIELRFVNGGGT
GSIKTTEQDYSVSEITIGSAFYAPKLFDYYKEVQFHPAVGFALPVVRKPAPTIYTCLGGG
YIASGAIGKDKEPEIWRPGGAKLLALEGAGEVQTPIFYNGEERVEIGDSILFRHSKAGEL
CERFPFLYRVKEGEIVGEYSTYRGDGQCFL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgaggaatttttaaagaagttccattaccttgtgcatttttggatgaagtggct
ttagatagaaatattcaatcgattatagaattaagtggaaataagaagattcgtatagcg
agtaaatcgttacgttctgttccggttatgcaaaggattttggctgcaagtgatcgattt
caaggtatcatgtgtttttcacctagggaagctttgtttttaattgaacaaggattcaat
gatttattgctcggatatcctgcttatgatgaaagagcgttacatgaaataagtttgcta
acaaagcaagggctcattataacttgtatggtggattgtgaagatcatattgtttattta
gaaaaaattgccgagaagtctaaaggatgttttcgtgtttgcttagatattgatatgagt
agtcgtttttttaagttccattttggggtcaaaagatcaccggtaaaagatgggcaaggt
gctttgaaaatagtaaaaaggttgaaagaatcatcatttttaatactagacggtgtaatg
ggatatgaagcccaaattgctggggtaggagatcacataccgaatcaacgagtgaaaagt
aaagtgatttcatatttaaagaagaaatcagtgttagaagttaaagaaagaagaggacat
atcttaaaagaaatacaaaatctaggtattgaactaaggtttgtaaatgggggaggcaca
ggaagtataaaaacaactgagcaagattattcagtttcagagattacaataggttcggct
ttttatgccccaaagctgtttgattattataaagaggtgcaatttcatccagctgtcgga
tttgctttaccagttgtgcgtaaaccagccccaacaatttacacttgtctaggtggcgga
tatattgcctcaggcgcaattgggaaagataaagaacctgaaatttggaggccgggtggt
gcaaaactattagctttagaaggcgctggtgaagtgcaaacaccgattttctataacggt
gaggaacgagtagagataggagattctatcttgtttcgccatagtaaagctggagaatta
tgtgagcggtttccttttttatatcgtgtgaaagaaggagagattgttggggagtattca
acatatcggggggatggccaatgctttctataa

DBGET integrated database retrieval system