KEGG   Bacillus cereus AH820: BCAH820_1234Help
Entry
BCAH820_1234      CDS       T00814                                 

Gene name
asnO1
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bcu  Bacillus cereus AH820
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCAH820_1234 (asnO1)
Enzymes [BR:bcu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BCAH820_1234 (asnO1)
Peptidases [BR:bcu01002]
 Cysteine Peptidases
  Family C44
   BCAH820_1234 (asnO1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1177600..1179447
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDYKRSLEGERDIVTKMAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPEGGK
QPMTCLKDEANYAICYNGELYNTEDIRKELLRRGYTFKGHSDTEVLLASYIEWKEECVDH
LNGIYAFSVWDEQKEQVFIARDRLGVKPLFYKYDSGRLLFGSELKAILAHPDVKAEVTLE
GLSEIFGLGPSRTPGHGIYAGIKELRPGHAMTFSKNGLCIWRYWNVESKKHEDSFEETVE
KTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYEKSGKGQLHTYSVDYEDND
KYFKANAFQPNSDAPFIHLMTETFQTIHHRCVISNEQLAQYLTEAVLVRDLPGMADIDSS
LLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSAFPWMRSTEAREQLLKKEWR
NKLNLQQYVQQRYEESIQEVPILDGESPLEAKRRQLFYLNMVWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYAWNIPWEMKMYKNREKGLLRKALEGLLPNEILYRKKSPYPKTHNP
HYTKAVTVWIQDLLTDKGSILHELFDKEQLSGLIESGGSAFQTPWYGQLMTGPQLLAHLA
QIHVWFKEYGVNIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattacaggatgggtggattataaacgctcattagaaggagaacgggacatc
gttacgaagatggctgagacgttagcgaagcgtggcccagatgataataaagtttggatt
aaaggcaatgtcgcatttgggcataaacggttaatcgttgttgatcctgaaggtggtaaa
cagccgatgacttgtttaaaggatgaagcaaattatgcaatttgctataacggcgaactg
tataacacggaagacattcgaaaggaactattaagaagaggatatacgttcaaaggtcac
tctgatacggaagtattgttagcttcttatatcgaatggaaagaagaatgtgtcgatcat
ttaaacggtatatatgcgttttctgtatgggatgaacagaaagaacaagtgtttattgcg
cgcgatcgattaggggtaaaaccactattttataaatatgacagtgggcgattactattt
ggctcagagttaaaagcgatattggcgcatccagatgtgaaggcggaagtgacgttagaa
ggattatctgaaatatttggccttggaccatctagaacgcctggtcacggtatttatgct
ggtataaaagaattacgtccaggtcatgcgatgacattttcgaagaacggtttatgtata
tggagatattggaatgtagaaagtaaaaagcatgaagattcttttgaagaaacagtagaa
aaaacacgctttttattacaagatgcgattacaaggcagctcgtttctgatgtaccatta
tgcacttttttatcaggcggtgtagattcaagcgctataacagcaattgctgcgaaagaa
tacgaaaaatcgggaaaaggtcaattacacacgtattcggttgattacgaagataatgac
aaatactttaaagcaaatgcgtttcagccaaattcagatgcaccatttattcatttgatg
actgagacgtttcaaacgatccatcatcgttgcgtcatttcaaatgaacaattagcgcag
tatttaacagaagcagtactcgttcgtgatttgcctggtatggcagatattgattcgtca
ttattatggttttgtcgtgaaattaaacaagattttgtcgttggtttatctggggaatgt
gcagatgaaatatttggtggttatccatggttttatagagaagatgatttacaatcgagt
gcatttccgtggatgcgttctacagaagcgcgtgaacaattgctaaagaaagaatggaga
aataaattaaatttacaacaatatgtacagcagcgctatgaagaatccattcaagaagtt
cctattttagatggggaaagtccgctagaagcaaaaagacgccaattattttatttaaat
atggtatggtttatgacaacattattagacagaaaagaccgcatgagtatgggggcaagc
ttagaagtgcgcgttccatttgcagatcaccgacttgtcgaatatgcgtggaatattcct
tgggaaatgaaaatgtataaaaaccgcgaaaaaggtctattgcgtaaagcgttagaaggg
ttacttccaaatgagatattatatagaaagaagagcccgtatccaaaaacacataatccg
cactatacgaaagcagtaacagtatggatacaagatttattaacggataaaggctcaatt
ttacacgagctatttgataaagaacagctgagtggattaattgagtcaggcggcagtgca
ttccaaacgccatggtatggtcaattaatgactgggccacagcttttagctcatttagcg
caaattcatgtttggtttaaagaatatggagtaaatattaaagaatag

DBGET integrated database retrieval system