KEGG   Bacillus cereus AH820: BCAH820_1297Help
Entry
BCAH820_1297      CDS       T00814                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bcu  Bacillus cereus AH820
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BCAH820_1297 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCAH820_1297 (rfbC)
Enzymes [BR:bcu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BCAH820_1297 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1239181..1239726
Genome map
AA seq 181 aa AA seqDB search
MKVIETNFTDAKLLEPRLFGDDRGFFTESYNKKVLETLGVTHSFVQDNVSYSAEAGTIRG
LHFQKNPKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHG
FCTLVPHTIVMYKVDEYYSADHDSGVLWNDKELAIPWPVTSPILSDKDRILPLLQECEDS
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatagaaacaaactttaccgacgcaaaattgttggaaccgaggttatttgga
gatgatcgtggcttttttactgaaagttataataagaaggtgctagaaacattaggggtt
acgcattcatttgtacaggataatgtctcgtattcagcggaagcgggaacgattcgcgga
ttacattttcaaaaaaacccgaaagcacaaacgaaacttattcaagttatgcaaggagca
atctatgacgttatcgtagatttgagaaaagattcaccaacgtttaaacagtggagagga
tatattttaagtgcggataatcatcggcaattattagtgccaaaaggatttgcacatggt
ttttgtacacttgtcccgcatacgattgttatgtataaagtagatgagtattatagtgcc
gatcatgactcaggggtactttggaacgataaagaattagcaattccatggccggtaaca
agtcctattttgtctgataaagatcgaatattaccattacttcaggaatgtgaagatagc
ttttga

DBGET integrated database retrieval system