KEGG   Bacillus cereus AH820: BCAH820_1321Help
Entry
BCAH820_1321      CDS       T00814                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bcu  Bacillus cereus AH820
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCAH820_1321 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCAH820_1321 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCAH820_1321 (trpB)
Enzymes [BR:bcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCAH820_1321 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258917..1260038
Genome map
AA seq 373 aa AA seqDB search
MQSVLELEEAYKEAMEDEAFQKELNHYLKTYVGRETPLYFAENMTEYCGGAKIYLKREDL
NHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHGVATATVCALLGLECVIFMGEEDVR
RQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRYWVSHVHDTHYIMGSVLGPHPFPQI
VRDFQSVIGNETKKQYEALEGKLPEAVVACIGGGSNAMGMFYPFVHDEEVALYGVEAAGK
GVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQEAHSISAGLDYPGVGPEHSLLKDIG
RVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVAYALKLAPQMKEDEGLVICLSGRGD
KDVESIKRYMEEV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctgtattagaactagaagaagcatataaagaggcgatggaagatgaagcattt
caaaaggaattaaatcattatttaaaaacgtatgtcggaagagaaacaccgctttatttc
gctgagaatatgacggagtattgcggaggtgcaaagatttatttaaaacgtgaagatttg
aaccatacaggagctcataaaattaacaatacaattggtcaggcacttcttgcggtgcga
atgggcaagaaaaaagttgtcgctgaaacaggggctggacaacacggtgttgcaacagct
acggtatgtgcccttctcggtttagagtgcgtcatctttatgggagaagaagatgtgaga
cgtcaaaaattaaatgtgtttcgaatggaattactcggagcgaaagtagaaagtgtagcg
gcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgttactgggtttcacac
gtgcatgatacgcactacattatgggatctgttctcggaccgcatccattcccgcaaatt
gtccgtgatttccaaagtgtaattgggaatgagacgaaaaaacaatatgaagcgttagaa
ggaaagttaccagaagcagtcgttgcttgcattggtggtgggagtaacgcaatgggaatg
ttttatccgtttgtacatgatgaagaagttgctctttacggcgtagaagcagctggaaaa
ggtgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtcggtgttttacac
ggatcaatgatgtatcttctgcaaaatgaagaaggtcaaattcaagaagcgcactctatt
tcagcagggcttgattacccaggtgttggtccagaacatagcttgctcaaagatattggc
cgcgtttcttatcattccattactgatgatgaagcgttagaagcgtttcaattattaacg
aaaaaagaagggattatcccggcgctagaaagctcgcatgctgtcgcatacgcattaaaa
ttagcgccgcaaatgaaggaagatgaaggacttgtcatttgtttatccggccgtggtgat
aaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system