KEGG   Bacillus cereus AH820: BCAH820_1321Help
Entry
BCAH820_1321      CDS       T00814                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bcu  Bacillus cereus AH820
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCAH820_1321 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCAH820_1321 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCAH820_1321 (trpB)
Enzymes [BR:bcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCAH820_1321 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1258917..1260038
Genome map
AA seq 373 aa AA seqDB search
MQSVLELEEAYKEAMEDEAFQKELNHYLKTYVGRETPLYFAENMTEYCGGAKIYLKREDL
NHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHGVATATVCALLGLECVIFMGEEDVR
RQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRYWVSHVHDTHYIMGSVLGPHPFPQI
VRDFQSVIGNETKKQYEALEGKLPEAVVACIGGGSNAMGMFYPFVHDEEVALYGVEAAGK
GVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQEAHSISAGLDYPGVGPEHSLLKDIG
RVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVAYALKLAPQMKEDEGLVICLSGRGD
KDVESIKRYMEEV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctgtattagaactagaagaagcatataaagaggcgatggaagatgaagcattt
caaaaggaattaaatcattatttaaaaacgtatgtcggaagagaaacaccgctttatttc
gctgagaatatgacggagtattgcggaggtgcaaagatttatttaaaacgtgaagatttg
aaccatacaggagctcataaaattaacaatacaattggtcaggcacttcttgcggtgcga
atgggcaagaaaaaagttgtcgctgaaacaggggctggacaacacggtgttgcaacagct
acggtatgtgcccttctcggtttagagtgcgtcatctttatgggagaagaagatgtgaga
cgtcaaaaattaaatgtgtttcgaatggaattactcggagcgaaagtagaaagtgtagcg
gcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgttactgggtttcacac
gtgcatgatacgcactacattatgggatctgttctcggaccgcatccattcccgcaaatt
gtccgtgatttccaaagtgtaattgggaatgagacgaaaaaacaatatgaagcgttagaa
ggaaagttaccagaagcagtcgttgcttgcattggtggtgggagtaacgcaatgggaatg
ttttatccgtttgtacatgatgaagaagttgctctttacggcgtagaagcagctggaaaa
ggtgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtcggtgttttacac
ggatcaatgatgtatcttctgcaaaatgaagaaggtcaaattcaagaagcgcactctatt
tcagcagggcttgattacccaggtgttggtccagaacatagcttgctcaaagatattggc
cgcgtttcttatcattccattactgatgatgaagcgttagaagcgtttcaattattaacg
aaaaaagaagggattatcccggcgctagaaagctcgcatgctgtcgcatacgcattaaaa
ttagcgccgcaaatgaaggaagatgaaggacttgtcatttgtttatccggccgtggtgat
aaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system