KEGG   Bacillus cereus AH820: BCAH820_1605Help
Entry
BCAH820_1605      CDS       T00814                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bcu  Bacillus cereus AH820
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCAH820_1605 (folE)
Enzymes [BR:bcu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BCAH820_1605 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1515390..1515959
Genome map
AA seq 189 aa AA seqDB search
MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHKVFG
EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIARRPQLQ
ERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARS
EILSFIKTK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttaatttagaacaaattgaacatgcagtacgccttattttagaggcaatt
ggagatgaccctaatcgagagggagtacttgatacaccaaagcgtgttgcaaaaatgtac
gcagaagtgttctcaggtatgcatgaagatccgaaagaacatttacacaaagtgttcgga
gaagatcatgaggagcttgtactagtaaaagatataccgttttattcgatgtgtgagcat
catttagttccattctatggagttgctcacgttgcatatattccgcaaggcggaaaagtg
acagggttaagtaaattagctcgtactgtagatacaattgcacgtcgtccacaactgcaa
gaacgtattacatcaacagtagcgaactctattatggaagtactagagccgcatggtgta
atggtagtagtagaagcagaacatatgtgtatgacgatgcgcggtgtgaaaaagccaggt
gcaaaaacagtaacaacagcagtacgtggtgtgctagaaaatgatgctgcagcacgtagt
gaaattttatcttttattaaaacgaagtaa

DBGET integrated database retrieval system