KEGG   Bacillus cereus AH820: BCAH820_1795Help
Entry
BCAH820_1795      CDS       T00814                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00010  Glycolysis / Gluconeogenesis
bcu00260  Glycine, serine and threonine metabolism
bcu00680  Methane metabolism
bcu01100  Metabolic pathways
bcu01110  Biosynthesis of secondary metabolites
bcu01120  Microbial metabolism in diverse environments
bcu01130  Biosynthesis of antibiotics
bcu01200  Carbon metabolism
bcu01230  Biosynthesis of amino acids
Module
bcu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcu_M00002  Glycolysis, core module involving three-carbon compounds
bcu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH820_1795
  Energy metabolism
   00680 Methane metabolism
    BCAH820_1795
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCAH820_1795
Enzymes [BR:bcu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCAH820_1795
Membrane trafficking [BR:bcu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCAH820_1795
Exosome [BR:bcu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCAH820_1795
  Exosomal proteins of melanoma cells
   BCAH820_1795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACK91373
UniProt: B7JIR4
Position
1695038..1695613
Genome map
AA seq 191 aa AA seqDB search
MTIIYFVRHAHSTYTKEERERPLSEKGHLDAENVTHLLKDKHIDVVISSPYKRAVQTVQG
IANTYHVSIEIEEGLRERLLSSEPIADFNDAIENVWEDWSFAYEGGESNDVAQRRAVICM
QSILKKYKGKNIVIGTHGNIMVLLMNYFDSKYDFRFWKTLRMPDIFKLNFHNEDLVSAER
IENTGHQINNL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacgataatatatttcgttcgccatgcccattctacatatacaaaagaagagcgggag
cgtcctttatctgaaaaagggcacttggatgcagagaatgtaacacacttattaaaagat
aaacatattgatgtagtgatttctagcccgtacaaaagagcagttcaaactgtacaagga
attgcgaatacatatcatgtatcaatagaaatagaagaaggtttacgagaaaggttatta
agttcagagccaatagcagattttaatgatgctattgagaatgtgtgggaagattggagt
tttgcatacgaaggcggagaatccaatgatgtagcacaaagacgcgctgtaatatgtatg
caaagtatattaaaaaaatataaaggtaaaaatattgtaataggtacgcatgggaatatt
atggtattacttatgaattattttgattcaaaatatgattttcgattttggaaaacactt
cgtatgcccgatatatttaagttgaattttcataatgaagatttagtttctgccgaaagg
atagagaatacgggtcatcagataaataatttgtaa

DBGET integrated database retrieval system