KEGG   Bacillus cereus AH820: BCAH820_2264Help
Entry
BCAH820_2264      CDS       T00814                                 

Gene name
dfrA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bcu  Bacillus cereus AH820
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bcu00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2152769..2153257
Genome map
AA seq 162 aa AA seqDB search
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEMDMTNWKEVFVEKGJTDEKNPYTYYYHVYEKQQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatagtttcatttatggtcgcaatggacgaaaatagagtaattggtaaagataataat
ttaccttggcgtttaccgagtgaattgcagtatgtaaagaaaacaacgatgggtcacccg
cttattatgggaagaaaaaactatgaagcgattggtagaccactgcctggaagacgtaat
attattgtaactcgcaatgaaggatatcatgttgaaggctgtgaagtagcacattctgta
gaagaagtgtttgagctatgcaaaaatgaagaagagatctttatttttggcggagcacaa
atttatgatctctttttaccttacgtagacaagttatatataacaaaaatccatcatgca
tttgaaggagatacatttttcccagaaatggatatgacaaattggaaagaagtttttgtt
gaaaaaggtwtaacggatgaaaaaaatccgtatacgtattattaccatgtatatgagaaa
caacaataa

DBGET integrated database retrieval system