KEGG   Bacillus cereus AH820: BCAH820_2509Help
Entry
BCAH820_2509      CDS       T00814                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00010  Glycolysis / Gluconeogenesis
bcu00260  Glycine, serine and threonine metabolism
bcu00680  Methane metabolism
bcu01100  Metabolic pathways
bcu01110  Biosynthesis of secondary metabolites
bcu01120  Microbial metabolism in diverse environments
bcu01130  Biosynthesis of antibiotics
bcu01200  Carbon metabolism
bcu01230  Biosynthesis of amino acids
Module
bcu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcu_M00002  Glycolysis, core module involving three-carbon compounds
bcu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH820_2509 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BCAH820_2509 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCAH820_2509 (gpm)
Enzymes [BR:bcu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCAH820_2509 (gpm)
Membrane trafficking [BR:bcu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCAH820_2509 (gpm)
Exosome [BR:bcu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCAH820_2509 (gpm)
  Exosomal proteins of melanoma cells
   BCAH820_2509 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACK88968
UniProt: B7JPK2
Position
2381985..2382722
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMDLAWVPVHKCWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDLRYKALKKGEFPLTECLVDTEKRVLDYWHSEIAPKLKNGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHITF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacaaagtttatggaatcttgaaaatcgtttt
actggttggactgatgtagatttatcagagaatggattaagtgaagcgagagaagcagga
gcgatattaaagaaaaatggatatacttttgatgtagcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgagatggaccttgcatgggtgccagtacat
aaatgttggaagttaaatgaaagacattacggtgcattgcaagggttgaataaagatgaa
actgcgaaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaggatgatcctaggtatgaaatgaatgatctaagatataaagca
ctgaaaaaaggtgagtttccattgacagaatgtttagtggatacggagaaaagagtactt
gattattggcattcagaaattgcgccgaaattaaagaatggtaacaaagtaatcatttca
tcacatggtaacacaattcgctcgctagtaaaatatttagataatctttcaagcgatggt
gttgtttcactaaatattccaacgagtattccgctcgtgtatgaattagacgaaaattta
cgtccgattcgccattattacttaagtatggatggagaagtacctgaaggagaaattccg
aaacatattactttttaa

DBGET integrated database retrieval system