KEGG   Bacillus cereus AH820: BCAH820_2509Help
Entry
BCAH820_2509      CDS       T00814                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcu  Bacillus cereus AH820
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAH820_2509 (gpmA)
   01230 Biosynthesis of amino acids
    BCAH820_2509 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH820_2509 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BCAH820_2509 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCAH820_2509 (gpmA)
Enzymes [BR:bcu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCAH820_2509 (gpmA)
Exosome [BR:bcu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCAH820_2509 (gpmA)
  Exosomal proteins of melanoma cells
   BCAH820_2509 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2381985..2382722
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMDLAWVPVHKCWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDLRYKALKKGEFPLTECLVDTEKRVLDYWHSEIAPKLKNGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHITF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacaaagtttatggaatcttgaaaatcgtttt
actggttggactgatgtagatttatcagagaatggattaagtgaagcgagagaagcagga
gcgatattaaagaaaaatggatatacttttgatgtagcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgagatggaccttgcatgggtgccagtacat
aaatgttggaagttaaatgaaagacattacggtgcattgcaagggttgaataaagatgaa
actgcgaaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaggatgatcctaggtatgaaatgaatgatctaagatataaagca
ctgaaaaaaggtgagtttccattgacagaatgtttagtggatacggagaaaagagtactt
gattattggcattcagaaattgcgccgaaattaaagaatggtaacaaagtaatcatttca
tcacatggtaacacaattcgctcgctagtaaaatatttagataatctttcaagcgatggt
gttgtttcactaaatattccaacgagtattccgctcgtgtatgaattagacgaaaattta
cgtccgattcgccattattacttaagtatggatggagaagtacctgaaggagaaattccg
aaacatattactttttaa

DBGET integrated database retrieval system