KEGG   Bacillus cereus AH820: BCAH820_2566Help
Entry
BCAH820_2566      CDS       T00814                                 

Definition
putative acetoacetyl-CoA synthase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcu  Bacillus cereus AH820
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAH820_2566
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH820_2566
   00620 Pyruvate metabolism
    BCAH820_2566
   00640 Propanoate metabolism
    BCAH820_2566
  Energy metabolism
   00680 Methane metabolism
    BCAH820_2566
Enzymes [BR:bcu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCAH820_2566
Lipid biosynthesis proteins [BR:bcu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCAH820_2566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2441372..2443312
Genome map
AA seq 646 aa AA seqDB search
MKQAVWFPTEEYKEKTRLYGWMKSLGYEDYETFYNKSIEETAWFWGEAEKAVGYQWMKPY
TEVLDLQNGTPFAQWYNGGTCNVVESVLSRWLADDETRTQPALQYEGENGTSKSFTYEEL
DSWVSRVANGLKHAGIEKGDRVTIYMPMIPETVVAMLAVMKIGAIISPIFSGFASDAVMT
RVQAAGSKMIITADGFSRRGKIVSLKDEVDKACEHCPTVEKVVIVRHAGNDFTPHNYDFS
WSTLEKEKPFVHAEEMHSDDPLMLIYTSGTTGKPKGTVHTHAGFPLKAAFDAGFGMNIKQ
GDRVLWVTDMGWMMGPFLLFGSLINGATMVMYEGVPDFPEADRLWETVDKYEITHLGISP
TLIRALMAKGDEYVNKHSLKSLEVFASTGEPWNPDPWMWLFEMVGKSNVPICNYSGGTEI
SGGIFGNVLIKPIAPISFNASLPGMAAVVLDDQGNPIRDEVGELCLEKPWVGMTKSFWED
DERYVNTYWSRFENKWVHGDWVVYDGEQYIITGRSDDTLNIAGKRIGPAEYESILVKHND
VIEAAAIGVPDDVKGEVCHCFVVLRDNVTFTGELKKELMSLVNSHIGKALCPKDIHVVED
LPKTRNSKVMRRVIKAAYLGKELGDLSSLVNPEVVPFIQGLQSSKL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaagcagtttggtttccaacagaagagtataaagaaaaaacacgcttatatggt
tggatgaaatcattggggtatgaagattatgaaacgttttataataaatctattgaagaa
acagcttggttttggggagaagctgagaaagcggttggctatcaatggatgaaaccttat
acagaagtgttagacctgcaaaatggtacaccgtttgcacagtggtataatggcggaaca
tgtaacgttgtagaatcagttttatcacgctggcttgcagatgatgaaacaagaacgcaa
ccagcacttcagtatgaaggagaaaatggaacttcaaaatcatttacatatgaagaactt
gatagctgggtaagtcgcgttgcaaatggtttgaaacatgcgggtattgaaaaaggcgac
cgagtaacaatttatatgccaatgattccagaaacagttgttgcgatgctagctgtaatg
aaaatcggagcaattatttcaccaatattctcaggatttgcgtctgatgcagtcatgaca
cgcgtgcaagcagcaggatcaaagatgatcattactgcagatggtttttcacgccgaggt
aagattgtttcattaaaagatgaagtagataaagcttgtgagcattgtccaactgttgaa
aaagtcgttatcgtgcgccacgcaggaaatgattttacaccgcataattatgatttctca
tggagtacgttagaaaaagaaaagccatttgtacatgctgaagaaatgcatagtgacgat
ccgttaatgctcatttatacatcaggtacaacaggaaaaccgaaagggaccgtgcacact
catgctggtttccctttgaaagcagcatttgatgcagggtttgggatgaatataaaacaa
ggcgaccgcgtattatgggtaactgatatgggctggatgatgggaccatttttactattt
ggctctctcattaatggagcaacgatggttatgtatgaaggtgttccggacttcccagaa
gcagatcgtttatgggagacagttgataaatatgaaattacacatctcggtatatcacca
acattaattcgtgcgttaatggcaaaaggtgatgagtatgtaaataaacattcgcttaag
agtttagaagtatttgcctcaacaggcgagccttggaatccagacccttggatgtggcta
tttgaaatggttggaaaaagtaatgtgccaatttgtaactattcaggcggaactgaaatt
tcaggtgggattttcgggaacgtccttattaaaccaattgcaccgattagctttaatgct
tctttaccagggatggcggcggttgtgctcgatgatcaaggtaatccaattcgcgatgaa
gttggagaattatgtttagagaaaccttgggttggtatgacgaaaagtttctgggaagac
gatgagcgttatgtgaacacatattggtcacgttttgaaaataaatgggttcatggtgac
tgggtggtttatgatggtgagcaatatattattacaggacgctcagatgatacgctaaac
attgctggaaaacgcattggacctgctgaatatgaatctattcttgtgaagcataatgat
gtcatagaagctgccgcgattggtgtaccagatgatgtaaaaggtgaagtttgtcattgt
tttgtagtattaagagataatgtaacatttacaggagaattaaagaaagaattaatgagt
ttagtaaactctcatattggaaaagcattatgtccaaaagatattcacgttgtagaagat
ttaccgaaaacgcgtaattctaaagtaatgcgacgtgtcattaaagctgcttatctaggg
aaagaattaggtgatttatcatcacttgtaaaccctgaagtagtgccatttattcaggga
ttgcagtctagtaaattataa

DBGET integrated database retrieval system