KEGG   Bacillus cereus AH820: BCAH820_2606Help
Entry
BCAH820_2606      CDS       T00814                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00010  Glycolysis / Gluconeogenesis
bcu00071  Fatty acid degradation
bcu00350  Tyrosine metabolism
bcu00625  Chloroalkane and chloroalkene degradation
bcu00626  Naphthalene degradation
bcu01100  Metabolic pathways
bcu01110  Biosynthesis of secondary metabolites
bcu01120  Microbial metabolism in diverse environments
bcu01130  Biosynthesis of antibiotics
bcu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH820_2606
  Lipid metabolism
   00071 Fatty acid degradation
    BCAH820_2606
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCAH820_2606
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCAH820_2606
   00626 Naphthalene degradation
    BCAH820_2606
Enzymes [BR:bcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCAH820_2606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ACK91284
UniProt: B7JPU9
Position
2476496..2477422
Genome map
AA seq 308 aa AA seqDB search
MEQNKLVLEGPKYLKWKTCKIKSIQDDEIIVKTIAGAISIGAELPQFKGSDVTDMNPIYP
RKTGYESYGEVIQVGNKVTNLKVGDRVVSFYGHDTIGIVKGDKVIRVPSYIEPKDALLSI
LSCDAAKGILKLNPRQNEKILITGMGVIGLLACYFLKYYVGVKHVDVVEPNKNRRDFAKK
FGAKNIYESEEQIKEAFHYGFECSATNSGFHTLQKALKTNGQICILSDGNIEELTLTADF
YQKELQIIGSSDGYDYQKHADWFFSQIEQTPWIEEIFQHEIQYTELIQCFEELNQGIITP
LKVFVSYK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaataaattagttttagaaggaccaaaataccttaagtggaaaacgtgtaaa
ataaagtctatacaggatgatgaaattatcgttaaaacaattgcaggggcaataagtatt
ggagcagagttaccgcagtttaaaggatccgatgttacagatatgaatcctatttatcca
agaaaaactggatatgaaagttatggtgaggttattcaagttgggaataaagtaacaaat
ttaaaagtaggtgatagggtagtttctttttatggacatgatacgataggaatagttaaa
ggggataaagtaattcgagtgcctagttatatagaacctaaagatgccttattatctatt
ctttcgtgtgatgctgctaaaggcatattgaaactaaacccacgacagaatgaaaagata
cttataactggaatgggagttataggtttacttgcttgttatttcttaaaatactatgta
ggtgttaagcatgtagatgttgtcgaacctaataaaaatagaagagattttgcaaagaag
tttggtgcaaaaaacatatatgaatcagaagaacaaataaaagaagcatttcattacggt
ttcgaatgttctgctacaaatagcggatttcatacattacaaaaagcacttaaaactaat
ggacaaatatgtatactttctgatggtaatattgaagaattaacattaaccgccgatttt
tatcagaaagaattgcaaatcattggttcaagtgatgggtatgattatcaaaaacatgca
gattggttttttagtcaaatagaacaaacaccatggatagaagagatttttcaacatgaa
atacaatatacagaactcattcaatgttttgaggaattaaatcaaggaataattacccct
ttaaaagtatttgtctcatataaataa

DBGET integrated database retrieval system