KEGG   Bacillus cereus AH820: BCAH820_2609Help
Entry
BCAH820_2609      CDS       T00814                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bcu  Bacillus cereus AH820
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BCAH820_2609
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCAH820_2609
Enzymes [BR:bcu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BCAH820_2609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2479087..2480568
Genome map
AA seq 493 aa AA seqDB search
MKLKELANLLLVKETIGDMNVKITGLEMDSRKITNGNLFICVSGIDGFLEDRHQFVEDAV
KNGAVALIVERDVNIEIPKIIVKDARYAMAVIASHFYGYPSNKMKLIGITGTNGKTTTSY
LIEKILSDYGYHTGLMGNNGVKVGSKWYSTDINTQEPPTLQRNLQMMKNQNADYCVMEVT
SQGLHMERVKGCNFKIAVFTNLTQDHLDYHGTFDEYKHVKSLLFARLGNDLSTTDKKIAV
LNADDPSVEYFKKITSAEVITYGIHNGADVQAKNITLSPKGIRFLVSSFNGEIEVSLNLV
GRFNVYNALAAITVALVEGIPLTNISDSLSTLKSIEGRMEIIDENQDFLVIVDYAHTPDA
LENVLSTISEFSKGKVITVFGCGGDRDAKKRSIMGGIAGSYSDFVFITSDNPRSEDPQAI
TKDIEKGFSQNNNLNYKVEVDRELAINHAINMASSNDIVLIAGKGHETYQILKDSTIHFD
DKEKARQAIINNR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactaaaagagctggcgaatttgttattggttaaagaaactattggcgatatgaat
gtaaaaattacgggattagaaatggattctagaaagataactaatggtaacctatttata
tgtgtatcaggtatcgatggttttcttgaagatcgacatcaatttgttgaagatgcagtg
aaaaatggtgctgtagcgctaattgtagaaagagatgtaaatattgagatacctaaaata
attgttaaagatgctaggtatgctatggcagttattgcgtcacatttctatggttatcca
tctaataaaatgaagttaattggaattacagggacaaatgggaaaacaactacttcttat
ttaattgaaaaaattttaagtgattatggatatcacacggggctcatggggaataacgga
gtcaaagttggttcaaaatggtattctactgatattaatacgcaagaacctccaacactt
caacggaatttgcaaatgatgaaaaatcaaaatgcagattattgtgttatggaagttacg
tcacaaggtttacatatggaaagagttaaagggtgtaactttaaaatagctgttttcaca
aatttaacacaagatcatttagattatcatggaacatttgatgaatataagcatgtaaaa
agtcttctttttgcgagattaggaaatgatttatctactacagataaaaaaatagctgtt
ttgaatgcagatgatccatcggtagaatactttaaaaaaattacttcagctgaggttatc
acatatggaatacataatggggcagatgttcaagcgaagaacataactttaagcccaaaa
ggaattcgttttttagtttcgtcctttaatggagaaatagaggttagccttaatcttgtg
ggtcgtttcaatgtttataatgcattagcagcaataacagttgcattggttgaaggtatt
ccgcttacaaacattagtgatagcttatctaccttaaagagtattgaaggtagaatggaa
atcatagacgaaaatcaagatttccttgtaatagtggactatgctcacacaccggatgcg
ttagaaaatgttctctctacaattagcgagttttcaaaaggtaaagttattacggttttc
ggttgtggtggagatagagacgcaaaaaaacgatctataatgggtggaattgcgggaagt
tatagcgattttgtttttattacttctgacaatccacgttcggaagatccgcaggcaata
acgaaggatattgaaaagggattttcgcaaaataataatttgaattataaagtagaagta
gatcgtgaacttgcaataaatcatgcaataaacatggcatcttctaatgatattgttttg
attgcggggaaagggcatgaaacgtatcaaattttaaaagattcaactattcattttgat
gataaagaaaaagctcgacaagcaattataaataatagatag

  All links  
No link information was found.   
DBGET integrated database retrieval system