KEGG   Bacillus cereus AH820: BCAH820_3849Help
Entry
BCAH820_3849      CDS       T00814                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bcu  Bacillus cereus AH820
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAH820_3849
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCAH820_3849
   00640 Propanoate metabolism
    BCAH820_3849
   00660 C5-Branched dibasic acid metabolism
    BCAH820_3849
Enzymes [BR:bcu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BCAH820_3849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3687753..3688454)
Genome map
AA seq 233 aa AA seqDB search
MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTEVCVVKAQIHAGGRGKAGGV
KVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ
VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKF
MMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDIFRTS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggtaaggcagtccttagaagctatggggttagcgttccg
aacgggaaggttgcatttacagtagaagaagctgtagaagcagcgaaagaattaggaacg
gaagtatgtgtagtaaaagcacaaattcacgctggtggacgcggcaaagctggcggagta
aaagttgcaaaaaatttagatgaagttcgtacatatgcagagagcattttaggaactaca
cttgtgacacatcaaacaggtcctgaaggtaaggaagtaaaacgcttacttatcgaagaa
ggttgcgatattaaaaaagaatattatgtaggtcttgttttagatcgtgcaacttctcaa
gttgttttaatggcgtctgaagaaggcggaacagaaattgaagaagtagcagaaaaaaca
ccagaaaaaatctttaaagaatatattgatccagcagtaggtttacaaggcttccaagca
cgccgaattgcatttaacatcaatattccaaaagagcttgtaggacaagctgtgaagttt
atgatgggcttataccgtgcgtttatcgaaaaagattgttctatcgcagagattaatcca
cttgttacaacaggtgacggtaaagttatggcattagatgcgaaattaaactttgattct
aacgctttatatcgccataaagacatttttagaacttcgtga

DBGET integrated database retrieval system