KEGG   Bacillus cereus AH820: BCAH820_4474Help
Entry
BCAH820_4474      CDS       T00814                                 

Definition
(GenBank) putative helicase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCAH820_4474
Enzymes [BR:bcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BCAH820_4474
DNA repair and recombination proteins [BR:bcu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BCAH820_4474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase UvrD_C AAA_12 T2SSE AAA AAA_22 AAA_16 AAA_29 NTPase_1 Zeta_toxin AAA_28 AAA_18 TsaE DUF4926 DEAD AAA_17
Motif
Other DBs
NCBI-ProteinID: ACK88762
UniProt: B7JPY0
Position
complement(4228047..4230383)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYLVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMRKDQLIRETMSLLNNQEGRVTEEDIISCIEMMQSEGKVIIEEERVYLASLFY
SEKGVVKSIRRLMNQEETPSFPEAEVLKTLGEIEEQLNVQYAPLQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNQK
DRSFIGCTGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQEVFNPK
REKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEAAFQSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagaaaaaaagtttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacgtacgacgaaaaaaaagtgatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacgttgacaggacattttaaagaccatccgaagtatggg
aaacaatatttagttgaaacgtttaagaaagaattgccgcaaacaaaagcaggtatggtg
caatatttagcgagtgatctatttaaagggataggaaaacgcacagctgaaaaaattgtg
gaccatctaggggaacatgctatttctaaaatcatggatgatcctgaggctttaaacggt
gttgttaacaaacaaaaagcgcaagaaatatatgagacaattgttgaacatcaaggatta
gagaaggtaatgagttttttaaatggttacggttttggaacgaagctttctattaagatt
tatcagcaatataaagagatgacattagaagtaattcgtaataacccatatcagcttatt
gaagaagtggatgggattggatttggaagagcggatgatatcggacgtgcgttagggata
tcgggtaatcatgatgatcgtgtacgtgcgggatgtttttatacgttagagaatgtatca
ttacaacttggtcacgtttatatgagaaaagatcaacttataagagaaacgatgtcactt
ttaaataatcaagaaggaagagtgacggaggaagacattataagctgtattgaaatgatg
caaagtgaagggaaagtcatcatcgaagaagagcgagtatatttggcatcgttattctat
tctgaaaaaggtgttgtgaagtctattcgcaggctcatgaatcaggaagaaacaccttca
tttcctgaagcagaagtgttaaagacgttaggtgaaattgaagaacaattgaacgtacag
tatgcgccgcttcagcaagaagcaattcaaacggcacttcataaaccgatgatgttattg
acaggtggaccaggaacaggaaaaacaacagttattaaaggaattgttgaaatgtatgcg
tcacttcacgggctatcgttaaatccgaatgaatatagtgatgataatccatttccgata
ctattaacagctccaacaggaagagcagcgaagcgaatgagtgaatcaacagggcttcca
gcttgcacaattcaccgtttacttggatggacgccagaagggtctttccagcgtaatgaa
acagatccggtacaagggaaattactcattattgatgaattttcaatggttgatatttgg
cttgcaaatcagctgtttaagtcattgccgactaacattcaagttatcgttgtaggcgat
gaagatcaattaccatctgtaggacctgggcaagtattgaaagatttattaaatgcaggt
gcagttccaacagtaaagcttactgaaatttatcgtcaagcggaaggttcatcagtgatt
caacttgcccatgcgataaaaaatggaacgctcccaccagatttagcgcaaaatcaaaaa
gatcgttcatttatcggctgcacaggagctcaaattgttgaagttgttaagaaggtttgc
gaaaacgctaagacaaaagggtttagcgcaagagatgtacaagtattggccccgatgtat
cgtggaccggctggtattaatgtactaaacgaagcgttgcaagaagtgtttaatccgaaa
agagaaaagagtaaagaaattgcttacggtgatgttgtataccgaagaggcgataaagtt
ttgcaactcgttaatcagccggagagccaagtatttaatggtgatatcggcgaaattgtt
tcggtgttttatgcgaaagaaaacgttgagcaacaagatatgattatcgtttcatttgat
ggaattgaggtaacatatacaaaaccagatttaaatcaaattacacatgcttattgctgt
tccattcataaatcgcaaggtagtgagtttcccattgtgattatgccgatagtgaaaagt
tataatcgtatgttacgtcgtaatttaatttatactggtattacaagaagtaagaagttc
cttattatttgcggggaggaagctgcttttcagtctggtgtaaatcgccttgatgatgca
atgcgtcaaacgactttagctagccgcttgcaagaatcacaaggagaagtacagatggta
acggttaatggcgaagagatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system