KEGG   Bacillus cereus AH820: BCAH820_5215Help
Entry
BCAH820_5215      CDS       T00814                                 

Gene name
estA
Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bcu  Bacillus cereus AH820
Brite
Enzymes [BR:bcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BCAH820_5215 (estA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4917164..4917907)
Genome map
AA seq 247 aa AA seqDB search
MMKLASPKPFTFEGGDRAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPIYKGHGVPPEE
LVHTGPEDWWQDVTEAYQLLKDKGFEKIAVVGLSLGGVFSLKLGYTVPVLGVVPMCAPMY
IKSEETMYQGILAYAREYKKREQKSPEQIEQEMLEFQKTPMNTLKALQQLIADVRNNVDM
IYAPTFVVQARHDEMINTDSANIIYNGVESTLKDIKWYEDSTHVITLDKQRDELHEDVYN
FLEQLDW
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattagcatctccgaaaccatttacatttgagggtggagaccgcgctgtttta
ttactacatggattcacaggaaactcagctgatgtacgtatgttagggcgtttcttagaa
aagaaaggctacacttgtcatgcgccaatttataaagggcacggagtaccaccagaagag
cttgttcatacaggtcctgaagattggtggcaagatgtaacggaagcatatcagctttta
aaagataaagggtttgagaaaattgctgtcgttggattgtcacttggcggagttttttca
ctaaaattaggttatacagtaccggttttaggtgtagtaccaatgtgtgcaccaatgtat
attaagagtgaagaaacgatgtaccaaggtatattggcatatgcccgcgaatataaaaaa
cgtgagcaaaaatcaccagagcaaatcgaacaagaaatgttggaattccaaaagacaccg
atgaatacattaaaagcattacaacaattaattgctgacgtacgtaacaatgtggacatg
atttatgcaccaacatttgttgtacaagcgcgtcatgatgaaatgattaatacagatagt
gcgaacattatttataacggtgtagaatcaacgttaaaagacattaaatggtatgaagac
tctacgcatgtcattacacttgataagcagcgtgacgagctacatgaggatgtatataac
ttcttggagcaactagattggtaa

DBGET integrated database retrieval system