KEGG   Bacillus cereus AH820: BCAH820_B0256Help
Entry
BCAH820_B0256     CDS       T00814                                 

Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bcu  Bacillus cereus AH820
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCAH820_B0256
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BCAH820_B0256
Enzymes [BR:bcu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     BCAH820_B0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pAH820_272:212523..213266
Genome map
AA seq 247 aa AA seqDB search
MGIRKNQACLTDEEKAAFVDAIQELKRNGEYQPYVDVHRKHFFHPIHQSAMFLPWHREFL
HKFEIELQKVNRNVTIPYWDWTVDNSITSSIWRGNFMGAFTGLNRQLGANPFLPTRTQVK
EAIDTTPYDTAPWRQVTSGFRSALEELHNGPHNWVGGVMAGAGSPEDPVFWLHHSNIDRL
WAIWQREHLNEPYLPTSGTTGADELGLDDPMHEFREGEKNTLTPKDVLDHTSLGYQYDNY
SLDPVDC
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggaataagaaaaaatcaagcatgtttgacagatgaagagaaggcagcttttgtagat
gcaattcaggaactaaaaagaaatggagaatatcaaccctatgttgatgtacatcgtaaa
catttttttcatcctatacatcaaagtgcaatgtttctcccatggcatcgtgaatttctt
cataaattcgaaattgaattacaaaaagttaatcgaaatgtgacaattccatattgggat
tggacggttgataattcaataacatcttcaatatggcgaggaaactttatgggagcattt
acagggctgaatcgtcaattaggtgcaaatccttttttgccaactcgtactcaagttaag
gaagctatagatacaacgccctatgatacagctccctggaggcaggtaacaagtggtttt
agaagtgcattagaagagttgcataatggtcctcataattgggttggaggagttatggca
ggagcaggatcacccgaagatccagttttttggttgcatcatagcaatattgatcgtctt
tgggctatatggcaaagagaacatcttaatgaaccttatttaccaactagtggtacaaca
ggtgcagatgaattgggactagatgatccaatgcatgaatttagagaaggagaaaaaaat
acattaactccgaaagacgtactagatcatacatctcttggatatcaatatgataactat
tcgttagatccagtagactgttga

DBGET integrated database retrieval system