KEGG   Beutenbergia cavernae: Bcav_0293Help
Entry
Bcav_0293         CDS       T00893                                 

Definition
esterase/lipase
Organism
bcv  Beutenbergia cavernae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(315500..316645)
Genome map
AA seq 381 aa AA seqDB search
MTDIPFGYLFGTALVALATAFALWPVRRPRPLSTISYFLGLALAELPVFALVLLTASSVL
AVSEGDVAGPGGQVVLALALLTSVGLAVVLARALPATAVLTAALQHDLGVAPGAARTPRR
VPTWLRALQGPVVVRPRNVTRVANIAYGPAGRRQQLDVLHRRDVPQGAPVLVYWHGGGYY
SGSKNREARPLLHRLAQRGWVCVSANYRLRPQAGFAEHLADAKSAIAWAHAHAAEFGGDP
STLVVAGSSAGAHLASICALTPDTSVSAAVCLYGWYDSYYGTGPADAPASSPFAYVNPDA
PPFFLTHGDHDTYAPVETARGFVRELRDASRQPVVYAELPGAHHAFDVFHSIRSEAVTDA
VETFLDVTLRDRDRGVRGSTR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatcccgttcggctacctgttcggcaccgccctcgtggcgctggcgacggcg
ttcgcgctctggccggtgcgccggccgcggcccctgtcgacgatcagctacttcctcggt
ctggccctggccgagctgccggtgttcgcgttggtcctgctcacggcgtcgtcggtgctc
gccgtgtccgagggcgacgtcgccggcccgggcgggcaggtcgtgctcgcgctcgcgctg
ctcacgagcgtgggcctcgccgtcgtcctcgcccgcgccctcccggcgacggcggtgctc
accgcggccctgcagcacgacctcggcgtcgcgccgggcgcggcacggacaccacgccgg
gttcccacgtggctccgagcgctccagggaccggtggtggtgcgcccgcgcaacgtcacg
cgcgtcgcgaacattgcgtacgggccggcgggccggcggcagcagctcgacgtgctgcac
cgccgcgacgtgccccagggcgcgcccgtgctcgtgtactggcacggcggcgggtactac
tcgggctccaagaaccgggaggcccggccgctcctgcaccggttggcccagcgaggctgg
gtctgcgtcagcgcgaactaccgcctgcgcccgcaggccggcttcgccgagcacctcgcc
gacgcgaagtcggcgatcgcctgggcgcacgctcacgcggcggagttcggcggtgacccg
tcgacactcgtggtcgccgggtcgtcagcgggcgcgcacctggcgtcgatctgtgctctc
acgcctgacacgtccgtgtcggccgccgtctgcctgtacgggtggtacgactcctactac
ggcacgggccccgccgacgcgccggcttcgtccccgttcgcgtacgtcaacccggacgcg
ccgccgttcttcctcacgcacggcgaccacgacacgtacgcgccggtggagaccgctcgc
gggttcgtccgggagctccgcgacgcgtcccggcagcctgtggtctacgccgagctgccc
ggcgcgcaccatgcgttcgacgtcttccactcgatccggtccgaagccgtcacggacgcc
gtcgagacgttcctggacgtcacgcttcgggatcgggaccgcggtgtgcgcgggagtacg
cgatga

DBGET integrated database retrieval system