KEGG   Beutenbergia cavernae: Bcav_0549Help
Entry
Bcav_0549         CDS       T00893                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bcv  Beutenbergia cavernae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcav_0549
DNA repair and recombination proteins [BR:bcv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bcav_0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
606312..606911
Genome map
AA seq 199 aa AA seqDB search
MYEGAVQDLITELGRLPGVGPKSAQRIAFHVLAADPDDVGRLAHALTEVKARVRFCETCG
NVSEEAQCRICLDPRRNAAILCVVEEPKDVVAIERTREFRGRYHVLGGAINPIDGVGPDD
LRIRELMTRLADGQVTEVIIATDPNVEGEATATYLARMLAGMGITVSRLASGLPVGGDLE
YADEITLGRAFEGRRRIDV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggcgcggtccaggacctcatcaccgagctcggccggctgccgggcgtaggt
cccaagagcgcgcagcgcatcgcgttccacgtgctcgccgcggacccggacgacgtcggc
cggctcgctcacgccctcaccgaggtgaaggcgcgggtccggttctgcgagacgtgcggc
aacgtctcggaggaggcgcagtgccgcatctgcctcgacccgcgtcgcaacgcagcgatc
ctgtgcgtcgtcgaggagccgaaggacgtcgtcgcgatcgagcgcacacgcgagttccgc
ggccggtaccacgtgctcggcggcgccatcaacccgatcgacggcgtgggtcccgacgac
ctgcgcatccgcgagctcatgacccggctcgcggacggtcaggtgaccgaggtgatcatc
gcgaccgacccgaacgtcgagggcgaggcgacggccacgtatctggcccgcatgctcgcc
ggcatggggatcaccgtctcgaggctcgcctcgggcctgccggtcgggggcgacctcgag
tacgccgacgagatcacgctgggcagggcgttcgaaggaaggcggaggatcgatgtctga

DBGET integrated database retrieval system