KEGG   Beutenbergia cavernae: Bcav_0611Help
Entry
Bcav_0611         CDS       T00893                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00010  Glycolysis / Gluconeogenesis
bcv00620  Pyruvate metabolism
bcv00640  Propanoate metabolism
bcv00680  Methane metabolism
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01120  Microbial metabolism in diverse environments
bcv01130  Biosynthesis of antibiotics
bcv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcav_0611
   00620 Pyruvate metabolism
    Bcav_0611
   00640 Propanoate metabolism
    Bcav_0611
  Energy metabolism
   00680 Methane metabolism
    Bcav_0611
Enzymes [BR:bcv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bcav_0611
Lipid biosynthesis proteins [BR:bcv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bcav_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACQ78873
UniProt: C5BXX9
Position
complement(677244..679247)
Genome map
AA seq 667 aa AA seqDB search
MPENGPVESGPALENLLVEERTFPPSPEFAAAAVASADLYEQASADRLGFWADQARELLD
WDTAFTEVLDFSDAPRARWFADGTLNAAFNAVDRHVAAGLGERVAIHWEGENGDTRTLTY
ADLQREISRAANVLGDLGVSTGDRVAIYLPMIPEAVIAMLACARIGAPHSVVFGGFSAEA
LHSRIVDAEAKLVITADGGYRRGAPSALKPAVDEALAKGGTPVEHVLVVRRTGQEVAWTD
DRDVWWHESVDAASETHAPVAVDAEHPLFILYTSGTTGKPKGIFHTTGGYLTQSAYTHRN
VFDLHPETDVYWCTADIGWVTGHTYVTYGPLVNGATQVMYEGTPDTPHRGRWWEIVQKYG
VTILYTAPTAIRTCMKWGGDIPAQFDLSSLRVLGSVGEPINPEAWMWYRRVIGGDRTPVV
DTWWQTETGAIMISPLPGVTAAKPGSAQVPLPGIVADVLDDAGKSVPNGSGGYLVLTEPW
PSMLRGIWGDEERFRETYWSRFPGSYFAGDGAKKDADGDIWLLGRVDDVMNVSGHRLSTT
EIESALVSHPWVAEAAVVGAQDATTGQAVVAFVILRAEAVEKADEEGEGHDVVAELRNHV
AKEIGPIAKPRSILVVAELPKTRSGKIMRRLLRDVAEHRQVGDVTTLADTSVMDLIATGL
ATAPSTD
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagaacggcccggtcgagtcggggcccgcactcgagaacctgctggtcgaggag
cgcaccttcccgccgagtccagagttcgcagccgcggccgtcgcctcggccgatctctac
gagcaggcctccgcagaccggctcggcttctgggccgaccaggcgcgtgagctgctggac
tgggacaccgcgttcaccgaggtgctcgacttctcggacgctccgcgcgcgcgatggttc
gccgacggcacgctgaacgcggcgttcaacgccgtcgaccggcacgtcgctgcggggctc
ggcgagcgggtggccatccactgggagggtgagaacggcgacacccgcacgctgacctac
gcggacctccagcgcgagatctcacgcgccgcgaacgtcctcggcgacctcggggtgtcc
acgggcgaccgggtggcgatctacctgcctatgatccccgaggccgtcatcgcgatgctc
gcgtgcgcccgtatcggcgcgccgcactccgtcgtgttcggcgggttctcggcggaggcg
ctgcacagccgcatcgtcgacgccgaggcgaagctcgtcatcacggctgacggcgggtac
cggcgtggggcgccgagcgcgctcaagccggccgtcgacgaggcgctcgccaagggcggc
acgcccgtggagcacgtgctcgtggtgcggcgcaccggccaggaggtcgcctggaccgac
gaccgcgacgtgtggtggcacgagagcgtcgacgccgcgtcggagacgcacgcaccggtc
gccgtcgacgccgagcacccgctgttcatcctctacacgtccggcacgacggggaagccg
aagggcatcttccacacgacgggcgggtacctcacgcagtcggcgtacacgcaccgcaac
gtgttcgacctgcacccggagacggacgtctactggtgcacggccgacatcggctgggtc
acggggcacacctacgtgacttacggccccctggtcaacggcgcgacccaggtcatgtac
gagggcacgccggacacgccgcaccgcgggcgctggtgggagatcgtccagaagtacggc
gtcaccatcctgtacaccgcacccaccgccattcgtacgtgcatgaagtggggcggggac
atccccgcccagttcgacctgtcgagcctgcgcgtgctgggcagcgtgggcgagcccatc
aaccccgaggcctggatgtggtaccgccgcgtcatcggcggcgaccggacgccggtggtc
gacacgtggtggcagaccgagaccggcgcgatcatgatctccccgctcccgggtgtcacg
gccgcgaagccgggcagcgcccaggtgccgctgccggggatcgtcgccgacgtcctcgat
gacgccgggaagtccgtcccgaacggctccggcggctacctcgtgctcaccgagccgtgg
ccctcgatgctgcgagggatctggggggacgaggagcggttccgcgagacgtactggtcg
cgcttcccgggcagctacttcgccggggacggcgcgaagaaggacgccgacggcgacatc
tggctgctcggtcgggtcgacgacgtcatgaacgtctccgggcaccggctctcgaccacc
gagatcgagtccgcgctcgtgtcgcacccgtgggtggcggaggccgccgtcgtcggtgcg
caggacgcgaccaccggccaggccgtcgtggcgttcgtcatcctgcgggcggaagccgtc
gagaaggcggacgaggagggcgagggtcacgacgtcgtcgccgagctccggaaccacgtc
gccaaggagatcgggccgatcgcgaagccgcgctcgatcctcgtggtcgcggagctgccg
aagacccggtccggcaagatcatgcgccggctcctgcgcgacgtcgccgagcaccggcag
gtgggcgacgtcaccacgctcgccgacacgtcggtcatggacctcatcgcgacgggtctg
gcgacggcgccgtccaccgactga

DBGET integrated database retrieval system