KEGG   Beutenbergia cavernae: Bcav_0703Help
Entry
Bcav_0703         CDS       T00893                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bcv  Beutenbergia cavernae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
780221..780823
Genome map
AA seq 200 aa AA seqDB search
MASPAGDGRAVRPYDAAGVERAVRDLLIAIGEDPDRDGLRETPERLARSYEEMFAGLHTD
PREAVQTFFDLEHNELVIVSDIAVYSVCEHHLLPFHGVAHVGYIPAPSGHVTGLSKLARL
VEAYARRPQVQERLTTQIADALVHALEPRGVVVVLECEHMCMSMRGVRKPGARTVTSAVR
GALREPATRAEAMSLIRGAR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccggccggtgacggtcgcgccgtccgcccgtacgacgccgcaggtgtcgag
cgggcggtacgcgacctgctgatcgccatcggggaggacccggaccgcgacgggctccgc
gagacccccgagcgcctcgcccgctcctacgaggagatgttcgccgggctgcacacggat
ccccgtgaggcggttcagacgttcttcgacctcgagcacaacgagctcgtgatcgtcagc
gacatcgccgtgtactccgtgtgcgagcaccacctcctgccgttccacggcgtcgcacac
gtcgggtacatcccggccccctcgggccacgtgaccggactgagcaagctggccaggctc
gtcgaggcgtacgcccgccgtccgcaggtgcaggagcggctgaccacgcagatcgccgac
gcgctggtccacgcgctggagccgcgcggcgtcgtcgtcgtgctcgagtgcgagcacatg
tgcatgtcgatgcgcggcgtccgcaagccgggcgcgaggaccgtgacctcggccgtgcgc
ggcgccctgcgcgagccggcgacgcgcgccgaggccatgagcctgatccggggtgcccgc
tag

DBGET integrated database retrieval system