KEGG   Beutenbergia cavernae: Bcav_0703Help
Entry
Bcav_0703         CDS       T00893                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bcv  Beutenbergia cavernae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bcav_0703
Enzymes [BR:bcv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Bcav_0703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
780221..780823
Genome map
AA seq 200 aa AA seqDB search
MASPAGDGRAVRPYDAAGVERAVRDLLIAIGEDPDRDGLRETPERLARSYEEMFAGLHTD
PREAVQTFFDLEHNELVIVSDIAVYSVCEHHLLPFHGVAHVGYIPAPSGHVTGLSKLARL
VEAYARRPQVQERLTTQIADALVHALEPRGVVVVLECEHMCMSMRGVRKPGARTVTSAVR
GALREPATRAEAMSLIRGAR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccggccggtgacggtcgcgccgtccgcccgtacgacgccgcaggtgtcgag
cgggcggtacgcgacctgctgatcgccatcggggaggacccggaccgcgacgggctccgc
gagacccccgagcgcctcgcccgctcctacgaggagatgttcgccgggctgcacacggat
ccccgtgaggcggttcagacgttcttcgacctcgagcacaacgagctcgtgatcgtcagc
gacatcgccgtgtactccgtgtgcgagcaccacctcctgccgttccacggcgtcgcacac
gtcgggtacatcccggccccctcgggccacgtgaccggactgagcaagctggccaggctc
gtcgaggcgtacgcccgccgtccgcaggtgcaggagcggctgaccacgcagatcgccgac
gcgctggtccacgcgctggagccgcgcggcgtcgtcgtcgtgctcgagtgcgagcacatg
tgcatgtcgatgcgcggcgtccgcaagccgggcgcgaggaccgtgacctcggccgtgcgc
ggcgccctgcgcgagccggcgacgcgcgccgaggccatgagcctgatccggggtgcccgc
tag

DBGET integrated database retrieval system