KEGG   Beutenbergia cavernae: Bcav_0704Help
Entry
Bcav_0704         CDS       T00893                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bcv  Beutenbergia cavernae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
780834..781763
Genome map
AA seq 309 aa AA seqDB search
MPTATSVPTGLGVPGDARRTLVMGVVNVTPDSFSDGGQWLAEDVAVAHGGRLVDEGADLL
DVGGESTRPGAERTPAAEELRRVRGVVERLAAAGAVVSIDTMRADVAQACVAAGAAVVND
VSGGQADVGMLDAVAALGVDYVVGHWDPSRTLTSRTPGDVTDVVVDDLAARLADARAAGI
AQERLVVDPCLGFGKDASANWDLLVHLARLRELGHRVLVGGSRKRFLGEIVGADRAPRDR
DHATAALTALAAAAGVWAVRVHDVGPSVDAARVAQAWIRAGGTAGTAGAAGTAGAAGIVG
RTGKETRDG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgccgacagcgacgagcgtgccgacggggctgggcgtgccgggcgacgcgcggcgcacg
ctcgtcatgggcgtcgtcaacgtcacgccggactcgttcagcgacggcggccagtggctc
gccgaggacgtggccgtcgcgcacgggggccgcctggtggacgagggcgccgacctgctc
gacgtcggcggcgagtcgacccgtcccggtgccgagcgcacgcccgccgccgaggagctg
cgccgggtgcgcggcgtcgtcgagcgcctggccgcggcgggcgccgtcgtcagcatcgac
acgatgcgcgctgacgtcgctcaggcctgcgtggcggcgggtgcggccgtggtcaacgac
gtgtccggcgggcaggcggacgtcgggatgctcgacgcggtcgccgcgctgggcgtggac
tacgtcgtcgggcactgggacccgtcccgcacgctcacgtcccgcacgcccggggacgtg
accgacgtcgtcgtcgacgacctggccgcacgcctcgccgacgcacgcgccgcagggatc
gcgcaggagcggctcgtcgtcgacccgtgcctggggttcggcaaggacgcgtcggcgaac
tgggacctgctcgtccacctggcccggctgcgcgagctcgggcaccgggtgctggtcggc
ggctcgcgcaagcgcttcctgggcgagatcgtgggtgcggaccgcgcgccgcgggaccgt
gaccacgccacggcggccctgaccgccctggccgccgcggccggggtgtgggcggtgcgg
gtgcacgacgtcggcccgtccgtcgacgccgcacgcgtcgcgcaggcgtggatccgggcg
ggcggcacggccgggaccgccggcgccgccgggactgccggcgccgccgggatcgtgggc
cgaacggggaaggagacacgggatggttga

DBGET integrated database retrieval system