KEGG   Beutenbergia cavernae: Bcav_0705Help
Entry
Bcav_0705         CDS       T00893                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
bcv  Beutenbergia cavernae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bcav_0705
Enzymes [BR:bcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Bcav_0705
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     Bcav_0705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
781756..782874
Genome map
AA seq 372 aa AA seqDB search
MVDRIRLAGIAARGFHGVLENERTEGQAFLADVTLWLDTTAAAASDDLADTVSYADVAQA
VVGVLTGPPVALLETLAQRVADAVLAYPLITSVEVTLHKPQAPMPVPVDDVELTVVRSRQ
GVSGYPNAGPVAAPSPAPEPAAPPVVAEPAAAAAVPVAPPGAPIPDAPEPAEQPAPAAPP
GVLHARPDEPVGVVLALGGNLGDVRATLRSAIAELSAVDGLDIEAVSPLARTAAVVVDGA
EPQPDYLNAVVRATTVLSPHELLDVAHEVERTYGRERSGEAPWPPRTLDIDIIDVEGVVA
SDAALDLPHPRAHQRAFVLVPWAQLDAAAFLPGLGGGPVDVLAQTAPDRDGVRWLALDWL
APGDAERSGGEE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggttgaccgcatccggctcgcggggatcgccgcgcgcgggttccacggcgtgctggag
aacgagcgcaccgaggggcaggcgttcctcgcggacgtgaccctctggctcgacacgacg
gccgccgccgccagcgacgacctcgccgacacggtgagctacgcggacgtcgcccaggcc
gtcgtcggcgtcctcaccgggccgccggtcgcgctgctcgagacgctcgctcagcgcgtg
gccgacgccgtgctcgcgtacccgctgatcacgtccgtcgaggtgaccctgcacaagccc
caggcgccgatgcccgtgccggtggacgacgtcgagctgacggtcgtgcggtcccggcag
ggtgtctcgggctacccgaacgccggcccggtcgcggcaccctccccggcgccggagccc
gcggccccgcccgtggtggcggaaccggcggccgcggccgccgtcccggtcgcgccaccg
ggcgcaccgatccccgacgccccggagcccgccgagcagccggcgcccgcggcaccgccg
ggcgtgctgcacgcccggcccgacgagcccgtcggcgtggtcctcgcgctcggcgggaac
ctcggcgacgtccgcgccacgctgcggtcggccatcgccgagctctccgccgtggacggg
ctcgacatcgaggcggtctccccgctcgcccgcaccgccgccgtcgtcgtcgacggtgcc
gaacctcagcccgactacctcaacgccgtcgtgcgcgccaccaccgtgctgagcccgcac
gagctcctcgacgtggcccacgaggtcgagcgcacctacggccgggagcggtccggcgag
gccccgtggccgccgcgcacgctggacatcgacatcatcgacgtcgagggggtcgtcgcg
agcgacgcggcgctcgacctgccgcacccgcgcgcccaccagcgcgcgttcgtgctcgtg
ccctgggcgcagctggacgcggcggcgttcctccccggcctcggcggcgggccggtcgac
gtgctcgcacagaccgcgccggaccgcgacggcgtccgctggctcgcgctcgactggctg
gccccgggcgacgcggagaggtccggcggcgaggagtga

DBGET integrated database retrieval system