KEGG   Beutenbergia cavernae: Bcav_0732Help
Entry
Bcav_0732         CDS       T00893                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcv  Beutenbergia cavernae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcav_0732
   01230 Biosynthesis of amino acids
    Bcav_0732
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcav_0732
  Energy metabolism
   00680 Methane metabolism
    Bcav_0732
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcav_0732
Enzymes [BR:bcv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bcav_0732
Exosome [BR:bcv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bcav_0732
  Exosomal proteins of melanoma cells
   Bcav_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
808005..808751
Genome map
AA seq 248 aa AA seqDB search
MGGMTYTLVLLRHGESEWNAKNLFTGWVDVPLSEKGTAEAIRGGQLLVEAGVLPDVVHTS
LLRRAISTANLALDAADRHWIPVHRSWRLNERHYGALQGKDKRQIRDEFGEEQFMTWRRS
YDVPPPEIELGSQFSQDGDPRYAGEPIPRTEALKNVLERALPYWNSEITPDLAEGKTVLV
AAHGNSLRAIVKHLDGVDDATIAGLNIPTGIPLVYELDDNFEPVTTGGRYLDPAAAAEAI
AAVANQGK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcatgacctacaccctggtgctgctccgccacggcgagagcgagtggaacgcg
aagaacctcttcaccggctgggtggacgtgccgctgtcggagaagggcaccgccgaggcg
atccgcggtggacagctcctcgtcgaggcgggcgtgctgcccgacgtcgtccacacctcc
ctgctgcgtcgtgcgatctcgacggcgaacctcgccctcgacgccgccgaccggcactgg
atcccagtgcaccgctcgtggcgcctcaacgagcggcactacggagcgctgcagggcaag
gacaagaggcagatccgcgacgagttcggcgaggagcagttcatgacctggcgccgctcg
tacgacgtgccgccgccggagatcgagctcggctcccagttctcgcaggacggcgacccg
cgctacgcgggcgagccgatcccgcgcaccgaggcgctgaagaacgtgctcgaacgggcg
ctgccgtactggaactcggagatcacgcccgacctcgccgagggcaagaccgtgctggtc
gccgctcacggcaactcgctgcgcgcgatcgtcaagcacctcgacggcgtcgacgacgcc
acgatcgccgggctcaacatcccgacgggcatcccgctcgtgtacgagctcgacgacaac
ttcgagccggtcaccacgggcggtcgctacctcgacccggccgcggccgcggaggcgatc
gcggcggtcgcgaaccaggggaagtag

DBGET integrated database retrieval system