KEGG   Beutenbergia cavernae: Bcav_0943Help
Entry
Bcav_0943         CDS       T00893                                 

Definition
glycoside hydrolase family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bcv  Beutenbergia cavernae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bcv00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bcv00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bcv00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1059269..1061410
Genome map
AA seq 713 aa AA seqDB search
MDRPAWRLRTASTTLELAAAPDELGPVLVDWYPDPASPGEARAVPGAEGHGVGGFATPAD
RLPLLYTALGTRHTRAAELAVDHGSGLVGARLRCTDVASASLPDGGDELRASFVDSTGHV
AVELDVVTHPEHDVVELRSRVTNTGDAPLVLDRALTAALALPVGPGAVVDLLGGHWSREF
SPFRVDLPAGELAIGSRQGITSHTYSPVVTVTSRDPSERGLRTEGRAQEDRDREHHRAYG
VALAWSGSWRMVVDAAPFRPDVRVSGGAGDDATRILLEAGASFEAPPLLAVCGRTAEHVT
AAWHDHARTVLARDLTPAHRPIVYNSWYATTFDVTPAHQLSLAEAAASLGVEVFVVDDGW
FRGRDHDRAGLGDWTPDPHAFPDGLDPLVSGVTALGMRFGIWMEPEAVNPDSDLYREHPD
WVYRAGDRPLVTLRHQYVLDLGRPEVESFVLDAVRAVLADERISYLKWDMNRPVSDGGRP
GDPHGREWALQHTHAYYRILRAIRAEFPHVTVEACSGGGGRVDLAVLALTDVVWPSDETG
PRDRLAIQHGFLSAYPPSVMSSWVTDAPDILDTDPASLELRFVVAMAGVLGVGSDLLAWD
AATRERARELVALYADVRDVVHTGHVVRHGSPADDVYAVEYGPTAAGRPVVLLVYGRPGR
AADVALPLATPDPGARYRVRSSGEVVSGADARAGLSVPFALADDADVVVLEPL
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
gtggaccgcccggcgtggcggttgcggacggcgtcgacgacgctggagctcgccgcggcg
ccggacgagctcggcccggtgctcgtggactggtacccggatccggcgtctcccggcgag
gcgcgggcggtccccggcgccgagggacacggcgtgggcggcttcgcgactccggcggac
cggctcccgctgctctacacggcactcgggacccgccacacccgggccgcggagctcgcg
gtcgaccacggctccgggctcgtcggcgcgcggctgcggtgcacggacgtcgcgagcgcg
tcgctgccggacggcggcgacgagctgcgcgcgtcgttcgtggactcgacgggtcacgtg
gcggtcgagctcgacgtcgtcacgcacccggagcacgacgtcgtggagctgcggtcccgc
gtgacgaacaccggcgacgcgccgctcgtgctcgaccgagcgctcaccgctgcgctggcg
ctgccggtcgggccgggcgccgtcgtcgacctcctcggcggtcactggtcgcgcgagttc
tcgcccttccgggtggacctgccggcgggggagctggcgatcgggagccgccaggggatc
acgtcgcacacgtactcgccagtcgtcaccgtcacgtcgcgcgacccgtccgagcgagga
ctccggaccgagggacgagcgcaggaggatcgcgaccgagaacaccaccgtgcgtacggc
gtcgcactggcgtggagcggatcgtggcggatggtcgtcgacgccgcgccgttccggccc
gacgtccgggtgagcggcggcgcgggcgacgacgcgacgcggatcctgctcgaggcggga
gcctccttcgaggcgccgccgctgctcgcagtgtgcggccgcaccgccgagcacgtgacc
gccgcatggcacgaccacgccaggaccgtcctggcgcgggacctcacgccggcccaccgg
ccgatcgtctacaactcctggtacgcgacgacgttcgacgtgacgcccgcccaccagctg
agcctcgcggaggcggcggcgtcgctcggcgtcgaggtgttcgtcgtcgacgacggctgg
ttccgtggacgcgaccacgaccgcgccggcctcggcgactggacgcccgacccgcacgcg
ttccccgacggcctggaccccctggtcagcggcgtgacggcgctggggatgcgcttcggg
atctggatggagcccgaggcggtcaacccggacagcgacctgtaccgggagcacccggac
tgggtgtaccgcgcgggagaccgaccgctcgtgacgctgcgccaccagtacgtgctcgac
ctcggccgccccgaggtcgagtccttcgtgctcgacgcggtccgcgccgtgctggccgac
gagcggatcagctacctcaagtgggacatgaaccggccggtcagcgacggcggccggccg
ggtgacccgcacgggcgggagtgggcgctgcagcacacgcacgcctactaccggatcctg
cgcgcgatccgcgccgagttcccgcacgtgaccgtcgaggcgtgctcgggcggcggcggc
cgggtcgacctcgcggtgctggccctgaccgacgtggtgtggccgagcgacgagaccggc
ccgcgggaccggctcgcgatccagcacggattcctctcggcgtacccgccgtccgtcatg
agctcgtgggtcaccgacgcgccggacatcctcgacacggatcccgcgagcctcgagctc
cggttcgtcgtcgcgatggcgggggtgctcggcgtcgggtcggacctgctcgcgtgggac
gccgcgacgcgggaacgggcgcgcgagctggtggcgctgtacgccgacgtgcgcgacgtc
gtccacacgggccacgtcgtcaggcacggctcgccggccgacgacgtctacgccgtcgag
tacggaccgacggcggccgggaggcctgtggtgctcctggtgtacggacggccgggtcgc
gcggcggacgtcgcgctgccgctcgcgacgccggatcccggggccaggtaccgggtgcgc
tcgtcgggcgaggtggtctccggggccgacgcccgggccgggctgagcgtcccgttcgcg
ctcgcggacgacgcggacgtcgtcgtgctcgagccgctgtga

DBGET integrated database retrieval system