KEGG   Beutenbergia cavernae: Bcav_0947Help
Entry
Bcav_0947         CDS       T00893                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bcv  Beutenbergia cavernae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bcv00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bcv00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1065593..1067095
Genome map
AA seq 500 aa AA seqDB search
MPAVIPVPSRTEAREGWFDLARAVRLVVPDAAAPEAERAREALARVGAQRVEVVTHDDGA
PGAIVLTLGDATLQPPAGVTRPDGVRPSAPPAEEYSLSVDPDRVVAEASTPEGLLRALAT
LEQLASVRDGGAGLEAVHVTDAPRYSWRGLMVDISRHFFGVPVLKDVVDLLALYKLNVLH
LHLSDDQGWRLDIGSRPELAKRSGDTEVGGGAGGFLTADDYVTLVTYAAERGVVVVPEID
LPGHTNAALHAVPELNPSGEATAVYTGTEVGFSALDLELPATEPFLRDVLGEVAALTPGD
YLHIGGDEVKTMTPEAYAAFVEKAAEIVVEAGKRPVVWQEGGKAQLPDGAVVQLWESNSS
PEAVLEAAARGARVVLSPGKHVYLDMKYHADYSLGLAWAGLVDVRESYDWDPDAYTPGLD
PAAIDGVEAALWTETVTTREELFTMLLPRLAAVAEVAWSAQDARALDDVARRLADHAALW
QERDWAFHPSDQVPWPSLTR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcagtcatccccgtcccgagccgcaccgaggcgcgcgagggctggttcgacctt
gcccgagcagtccggctcgtcgttcccgacgcggcggcgccggaggcggagcgcgcacgc
gaggcgctcgcccgggtcggcgcccagcgggtcgaggtcgtgacgcacgacgacggcgcg
ccgggcgcgatcgtcctcacgctcggcgacgcgacgctgcagccgcccgcgggggtcacg
cggccggacggcgtccggccgtcggcgccgccggccgaggagtactcgctgagcgtcgac
cccgaccgggtggtggcggaagcctcgaccccggaagggctgctgcgggcgctcgcgacg
ctcgagcagctcgcgagcgtgcgcgacggcggagcgggcctcgaggccgtccacgtcacc
gacgctccgcggtactcctggcgcggcctcatggtcgacatctcgcgccacttcttcggc
gtccccgtgctcaaggacgtcgtcgacctgctcgcgctgtacaagctcaacgtgctgcac
ctgcacctcagcgacgaccagggctggcgcctggacatcggctcccgtccggagctcgcc
aagcgctcgggcgacacggaggtcggcggcggggcgggcggcttcctcaccgctgacgac
tacgtgacgctcgtgacctacgcggcggagcgcggcgtcgtcgtcgtccccgagatcgat
ctgcccgggcacacgaacgccgcgctgcacgcggtgccggagctcaacccgtcgggcgag
gcgacggccgtctacacgggcaccgaggtcgggttctccgcgctcgacctcgagctgccc
gccacggagccgttcctgcgcgacgtgctcggcgaggtcgccgcgctcacgcccggcgac
tacctccacatcggtggcgacgaggtcaagaccatgaccccggaggcgtacgccgccttc
gtcgagaaggccgcggagatcgtcgtcgaggccggcaagcggccggtcgtgtggcaggag
ggcggcaaggcgcagctgccggacggcgccgtcgtgcagctgtgggagtcgaacagctcg
ccggaggccgtgctcgaagcagcggcccgcggcgctcgggtggtgctctcacccggcaag
cacgtgtacctcgacatgaagtaccacgcggactattccctgggcctggcctgggctggc
ctcgtcgacgtgcgcgagagctacgactgggacccggacgcgtacacgcccgggctcgac
cccgcggcgatcgacggcgtcgaagcggcgctctggacggagacggtgacgacgcgcgag
gagctgttcacgatgctgctcccgcggctcgccgccgtcgcggaggtcgcgtggtcggcg
caggacgctcgcgcgctcgacgacgtggcacggcgtctggccgatcacgcggccctgtgg
caggagcgcgactgggcgttccacccgagcgaccaggtgccgtggccgagcctcacccgg
tga

DBGET integrated database retrieval system