KEGG   Beutenbergia cavernae: Bcav_0976Help
Entry
Bcav_0976         CDS       T00893                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00900  Terpenoid backbone biosynthesis
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01130  Biosynthesis of antibiotics
Module
bcv_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcav_0976
Enzymes [BR:bcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bcav_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACQ79237
UniProt: C5C051
Position
1109568..1110497
Genome map
AA seq 309 aa AA seqDB search
MSAAPDSAPRVHVRAPGKINLVLRCGAPGEDGYHRLATVFQAVSLYEDVVAELADDVTVT
VTGRQADVVPTDGENLAVRAARLLADSTGTAEGVRLHVTKNVPVSGGMGGGSADAAATLL
ACDLLWGTGLARDELAELAAELGADVPFALTGQTAVGTGRGDVLAPALARGTHHWVLATQ
SWGLPTPEVYARFDELRPDPAPPRLEDGLMAALVGGSSADLADYVANDLADAAVALRPEL
AGVLDAFDAAGALARTVSGSGPTVFGLAADLADAQDVAASVRDAGVADDVLLVTGPVSGA
RALESMRGV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgcgcccgactccgcgccgcgggtccacgtgcgcgcgccgggaaagatcaac
ctcgtcctgcggtgcggcgcgcccggtgaggacggctaccaccgccttgcgacggtgttc
caggcggtctcgctctacgaggacgtcgtcgccgagctcgctgacgacgtgacggtgacg
gtcacggggcggcaggccgacgtcgtccccaccgacggggagaacctcgccgtgcgggcg
gctcgtctcctcgccgactcgaccgggacggcagagggcgtgcggctgcacgtcacgaag
aacgtgccggtctccggcgggatgggcggagggtcggccgacgcggccgcgaccctcctc
gcgtgcgacctgctgtgggggacgggcctggcgcgcgacgagctcgcggagctggccgcc
gagctgggcgccgacgtgccgttcgcgctcaccgggcagacggcggtcggcaccggccgt
ggcgacgtgctcgcgccggcgctggcccgggggacgcaccactgggtgctcgcgacgcag
tcgtggggcctgccgacccccgaggtctacgcccggttcgacgagctgcggccggacccc
gcgccgccgcggctcgaggacgggctcatggcggccctcgtgggtgggtcgagcgccgac
ctggccgactacgtcgcgaacgacctcgccgacgccgccgtcgcgctgcgcccggagctc
gccggcgtcctcgatgccttcgacgccgcgggcgccctcgcccgcacggtctccgggtcg
ggcccgacggtgttcgggctcgccgccgacctcgccgatgcgcaggacgtcgccgcgtcc
gtccgggacgccggcgtggcggacgacgtcctcctcgtcacggggccggtcagcggtgcc
cgcgcgctggagtcgatgcgcggcgtctga

DBGET integrated database retrieval system