KEGG   Beutenbergia cavernae: Bcav_0976Help
Entry
Bcav_0976         CDS       T00893                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bcv  Beutenbergia cavernae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bcv00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1109568..1110497
Genome map
AA seq 309 aa AA seqDB search
MSAAPDSAPRVHVRAPGKINLVLRCGAPGEDGYHRLATVFQAVSLYEDVVAELADDVTVT
VTGRQADVVPTDGENLAVRAARLLADSTGTAEGVRLHVTKNVPVSGGMGGGSADAAATLL
ACDLLWGTGLARDELAELAAELGADVPFALTGQTAVGTGRGDVLAPALARGTHHWVLATQ
SWGLPTPEVYARFDELRPDPAPPRLEDGLMAALVGGSSADLADYVANDLADAAVALRPEL
AGVLDAFDAAGALARTVSGSGPTVFGLAADLADAQDVAASVRDAGVADDVLLVTGPVSGA
RALESMRGV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgcgcccgactccgcgccgcgggtccacgtgcgcgcgccgggaaagatcaac
ctcgtcctgcggtgcggcgcgcccggtgaggacggctaccaccgccttgcgacggtgttc
caggcggtctcgctctacgaggacgtcgtcgccgagctcgctgacgacgtgacggtgacg
gtcacggggcggcaggccgacgtcgtccccaccgacggggagaacctcgccgtgcgggcg
gctcgtctcctcgccgactcgaccgggacggcagagggcgtgcggctgcacgtcacgaag
aacgtgccggtctccggcgggatgggcggagggtcggccgacgcggccgcgaccctcctc
gcgtgcgacctgctgtgggggacgggcctggcgcgcgacgagctcgcggagctggccgcc
gagctgggcgccgacgtgccgttcgcgctcaccgggcagacggcggtcggcaccggccgt
ggcgacgtgctcgcgccggcgctggcccgggggacgcaccactgggtgctcgcgacgcag
tcgtggggcctgccgacccccgaggtctacgcccggttcgacgagctgcggccggacccc
gcgccgccgcggctcgaggacgggctcatggcggccctcgtgggtgggtcgagcgccgac
ctggccgactacgtcgcgaacgacctcgccgacgccgccgtcgcgctgcgcccggagctc
gccggcgtcctcgatgccttcgacgccgcgggcgccctcgcccgcacggtctccgggtcg
ggcccgacggtgttcgggctcgccgccgacctcgccgatgcgcaggacgtcgccgcgtcc
gtccgggacgccggcgtggcggacgacgtcctcctcgtcacggggccggtcagcggtgcc
cgcgcgctggagtcgatgcgcggcgtctga

DBGET integrated database retrieval system