KEGG   Beutenbergia cavernae: Bcav_1252Help
Entry
Bcav_1252         CDS       T00893                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bcv  Beutenbergia cavernae
Brite
Enzymes [BR:bcv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Bcav_1252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1423642..1426701
Genome map
AA seq 1019 aa AA seqDB search
MQLARRIETIGTSLLALVLVTGTASLGNAVGAPPPEPAAPAQAVVTSDFEDGTTQGWSGR
GSASVAVTADAAHDGAASLLVTGRTQAWNGASLDVTSAFEAGTTYGVDLWLRLATGAEPT
DLRVSVQRDAGGSSIFDTVATVSATADAWVQVAAEYTMPAAAEATQLYVESTGSLTDFLL
DGVVVTGEEVPPVQEDIPPLRDVLAGDFGIGVAIDARETTGASAQLLTRHFGQITAENAM
KPESIQPTEGEFTFEAADALVAFAQQNDLRVYGHTLVWHSQTPEWFFARADGTPLTSSPE
DQAILLGRMEAHITAMGERFGDAAWAWDVVNEAIDESQPDGLRRSRWYEVLGPDYLTHAF
RFADAAFPDAQLFLNDYNTEFPAKREAMYRVVADLIADGVPIDGVGHQLHVNLTRPVAQV
DATLARFAELGVAQAVTELDVSISRSADESLPTTPPERLVEQGYYYRDLFEVLRAHELAS
VTLWGLHDGRSWLRTWPIERPHEAPLAFDDRLQAKPAYWGIVDPGQLPHLPRAARVPAAA
VELGPDAPTDPEWSLVPLTEVGASEAGTSTFGGRWDASRLTVLVRVADATPEGDDAVELF
ADGPVPYRVARDGTTTGEGSGAVVIERPDGTGYDVVAALPLTAAEPGASVPFDLRLTDAS
VGQVSWSDLSHTQETRPERRGALELSEEVPVVDVPLARVVPVVDGVVEAAWDGAVVVATG
VQVEGTPGASADVRLLWSDGALHALAEVTDPEIDTSNSNAWEQDSVEIFLDPGNTKAGAY
DPDDGQYRVSATGHVSISGDLEVIGDNLTSAATLTPTGYVVEASLVLDGAATSVLAGLEL
QVNDATDGARSSVRTWADPTGLSYQNTSRWGVARLAGRAVPACTSTVTDDVRGPLVISDG
VTCLDGAEVRGPVLVRTGASLVARTAEIRGPLAVSRAGVVHLEDVRVSGPIAVSGAEVLR
LDRADVRGPVGITGVSHLAIVSGSTIAGPLACWGNAATPTDDGVANVVRGPTFGQCAGF
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcgcccgacgaatcgaaactatcggaaccagcctgctggccttggtcctcgtg
accggcacggcgagcctcgggaacgccgtcggcgcgccgccccctgaaccagccgcgccg
gcgcaggccgtcgtgacatccgacttcgaggacggcaccacgcagggctggtcgggccga
ggtagcgcgagcgtcgccgtcaccgccgacgccgcccatgacggcgcggcgagcctgctc
gtgacgggccggacccaggcgtggaacggcgcatccctcgacgtcacctccgcgttcgag
gcggggaccacctacggcgtcgacctctggctccgcctcgccacgggcgcggagccgacc
gacctgcgcgtcagtgtccagcgtgacgccgggggctcctcgatcttcgacacggtcgcg
accgtctccgccacggccgatgcgtgggtccaggtcgcggccgagtacacgatgcccgca
gcagccgaggccacccagctgtacgtcgagtcgaccgggtctctcacggacttcctgctc
gacggcgtcgtcgtgaccggggaggaggtgccgccggtgcaggaggacatcccgccgttg
cgcgacgtcctggctggcgacttcggcatcggcgtcgccatcgacgcacgcgagacgact
ggcgcgtcggcccagcttctgacgcgccacttcgggcagatcaccgccgagaacgcgatg
aagcccgagtccatccagccgacggagggtgagttcacgttcgaggcggctgacgcgctc
gtcgcgttcgcgcagcagaacgatctgcgcgtctacgggcacacgctcgtgtggcacagc
cagaccccggagtggttcttcgcccgcgccgacggtacgccgctcacgagcagcccagag
gaccaggcgatcctgctcggccggatggaggcccacatcacggccatgggcgagcgtttc
ggcgacgccgcgtgggcgtgggacgtcgtcaacgaggcgatcgacgagagccagcccgac
gggctgcgccgcagccgctggtacgaggtgctcggtcccgactacctcacccatgcgttc
cgtttcgcggacgcggcgttcccggacgcgcagctcttcctcaacgactacaacacggag
ttccccgcgaagcgagaggcgatgtaccgggtcgtcgcggacctgatcgccgacggcgtc
ccgatcgacggcgtcgggcaccagctgcacgtcaacctcacccggccggtcgcccaggtc
gacgcgacgctggcgcgattcgccgagctcggggttgcccaggccgtgacggagctcgac
gtgagcatctcccggagcgcggacgagagcctcccgacgaccccgcccgaacgactcgtc
gagcagggttactactaccgcgacctgttcgaggtgctgcgggcgcacgagctcgcctcc
gtcaccctctggggcctgcacgacggccgcagctggctgcggacgtggcccatcgagcgt
ccccacgaggcgccgctcgcgttcgatgaccggctgcaggccaagccggcgtactggggg
atcgtcgacccgggccaactgccgcacctgccacgcgccgcgcgcgtcccggcggccgcc
gtcgagctcggcccggacgcccccaccgaccccgagtggtcgctcgtcccgctcaccgag
gtcggggcgagcgaggcgggcacgtcgacgttcggaggccgctgggacgcgagccgcctc
acggtgctcgtccgggtggccgacgccacgcccgagggggacgacgccgtcgagctcttc
gccgacggtcccgtgccctaccgcgtggcgcgcgacgggacgacgacgggggaggggagc
ggggccgtcgtgatcgaacgccccgacggaacggggtacgacgtcgtcgcggcccttccg
ttgaccgcggcggagccgggcgcgtcggtgccgttcgacctccggctcaccgacgcgtcc
gtcggccaggtctcgtggagcgatctcagccacacgcaggagacgcgccccgaacgtcgc
ggtgcgctcgagctgtccgaggaggtgccggtcgtggacgtgccgctcgcccgggtcgtc
ccggtggtcgacggcgtggtcgaggcggcgtgggacggtgcggtggtcgtcgcgacaggc
gtccaggtcgagggcacaccgggcgcgagtgcggacgtccggcttctgtggtccgacgga
gccctgcacgcgctcgccgaggtgacggacccggagatcgacacgtcgaactcgaacgcg
tgggagcaggactcggtcgagatcttcctggacccgggcaacacaaaggccggcgcgtac
gaccccgacgacggccagtaccgcgtcagtgccacagggcacgtctcgatcagcggtgac
ctcgaggtcatcggcgacaacctcacgagcgccgcgactctcaccccgacggggtacgtc
gtcgaggcgtcgctggtgctcgacggcgccgcgaccagcgtgctcgccggcctggagctg
caggtcaacgacgccaccgacggcgcacgctcgtccgtgagaacctgggccgacccgacc
gggctgtcgtaccagaacacctcgcgctggggcgtcgcgcgcctggcggggcgggcggtg
ccagcctgcacgagcacggtgacggacgacgtgcgcggaccgcttgtgatctccgacggc
gtcacgtgcctcgacggtgccgaggtccgcggaccggtcctcgtgcgcaccggcgcgagc
ctggtcgctcgaactgcggagatccgtggccccctggccgtgagcagggccggcgtggtg
cacctcgaggacgtgcgggtgtccgggccgatcgccgtgtccggcgccgaggtcctgcgc
ctggaccgtgctgacgtccgcgggcccgtcggcatcaccggcgtgtcacacctcgccatc
gtgtccggttctacgatcgccggcccgctcgcgtgctgggggaacgcggcgacgcccacc
gacgacggcgtggcgaacgtcgtgcgcggcccgaccttcgggcagtgcgccgggttctag

DBGET integrated database retrieval system