KEGG   Beutenbergia cavernae: Bcav_1282Help
Entry
Bcav_1282         CDS       T00893                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bcv  Beutenbergia cavernae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcav_1282
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcav_1282
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bcav_1282
Enzymes [BR:bcv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bcav_1282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1457657..1458718
Genome map
AA seq 353 aa AA seqDB search
MAQPWRGIIAEYAEYLPLADGDPVVTLGEGGTPLVEAPALSARTGARVYLKVEGANPTGS
FKDRGMAVAISKVVAAGSPTVVCASTGNTSASAAAYAARAGLACAVVLPAGKIAAGKLAQ
AIVHGATLVAVDGNFDDCLTIVRELAASDAVALVNSVNPYRLQGQKTAAFEIVDTLGDAP
AVHVLPVGNAGNISAYWMGYREYAAAGRANRTPVMWGVQAEGAAPFVKGEPVEHPETVAT
AIRIGNPASWDLAVAARDESGGRIDAVSDAEILDAQALIAREVGVFVEPASAASVAGLLA
RARAGDVPESATIVCTVTGNGLKDTATALGDTPIAPVSVSARTADVARVLGLD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcccagccgtggcgcggcatcatcgccgagtacgccgagtacctgcccctcgccgac
ggcgatcccgtcgtgacgctgggcgagggcggcacgccgctggtcgaggctccggcgctg
tcggcgcggacgggcgcccgcgtgtacctcaaggtcgagggggccaacccgaccggctcg
ttcaaggaccgcggcatggccgtcgcgatctccaaggtcgtggcggcggggtcgccgacg
gtcgtctgcgcctcgacgggcaacacgtccgcctccgccgccgcctacgccgcgcgcgcg
ggcctcgcctgcgccgtcgtcctgcccgccgggaagatcgcggcgggcaagctcgcccag
gcgatcgtgcacggcgccacgctcgtggccgtcgacgggaacttcgacgactgcctgacg
atcgtgcgggagctcgccgcgagcgacgccgtcgccctggtgaactcggtcaacccgtac
cgcctccaggggcagaagacggcggcgttcgagatcgtcgacacgctcggcgacgctccg
gccgtccacgtgctcccggtcggcaacgcaggcaacatctcggcctactggatgggctac
cgcgagtacgccgccgccggccgcgcgaaccggacgcccgtgatgtggggcgtgcaggcg
gagggcgcggcgccgttcgtcaagggtgagccggtcgagcatcccgagacggtcgcgacg
gcgatccggatcggcaacccggcctcgtgggacctcgccgtcgccgcgcgggacgagagc
gggggccgcatcgacgccgtcagcgacgccgagatcctcgacgcgcaggcgctgatcgcg
cgcgaggtcggggtgttcgtcgaaccggcgtcggccgcgtcggtggccggactgctcgcc
cgcgcgcgggccggtgacgtgccggagagtgccaccatcgtgtgcacggtcacggggaac
gggttgaaggacacggcgacggcgctcggggacacgccgatcgcaccggtgagcgtgtcc
gcgcgaacggccgacgtcgcgcgggtgctcgggctggactga

DBGET integrated database retrieval system