KEGG   Beutenbergia cavernae: Bcav_1282Help
Entry
Bcav_1282         CDS       T00893                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bcv  Beutenbergia cavernae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcav_1282
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcav_1282
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bcav_1282
Enzymes [BR:bcv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bcav_1282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1457657..1458718
Genome map
AA seq 353 aa AA seqDB search
MAQPWRGIIAEYAEYLPLADGDPVVTLGEGGTPLVEAPALSARTGARVYLKVEGANPTGS
FKDRGMAVAISKVVAAGSPTVVCASTGNTSASAAAYAARAGLACAVVLPAGKIAAGKLAQ
AIVHGATLVAVDGNFDDCLTIVRELAASDAVALVNSVNPYRLQGQKTAAFEIVDTLGDAP
AVHVLPVGNAGNISAYWMGYREYAAAGRANRTPVMWGVQAEGAAPFVKGEPVEHPETVAT
AIRIGNPASWDLAVAARDESGGRIDAVSDAEILDAQALIAREVGVFVEPASAASVAGLLA
RARAGDVPESATIVCTVTGNGLKDTATALGDTPIAPVSVSARTADVARVLGLD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcccagccgtggcgcggcatcatcgccgagtacgccgagtacctgcccctcgccgac
ggcgatcccgtcgtgacgctgggcgagggcggcacgccgctggtcgaggctccggcgctg
tcggcgcggacgggcgcccgcgtgtacctcaaggtcgagggggccaacccgaccggctcg
ttcaaggaccgcggcatggccgtcgcgatctccaaggtcgtggcggcggggtcgccgacg
gtcgtctgcgcctcgacgggcaacacgtccgcctccgccgccgcctacgccgcgcgcgcg
ggcctcgcctgcgccgtcgtcctgcccgccgggaagatcgcggcgggcaagctcgcccag
gcgatcgtgcacggcgccacgctcgtggccgtcgacgggaacttcgacgactgcctgacg
atcgtgcgggagctcgccgcgagcgacgccgtcgccctggtgaactcggtcaacccgtac
cgcctccaggggcagaagacggcggcgttcgagatcgtcgacacgctcggcgacgctccg
gccgtccacgtgctcccggtcggcaacgcaggcaacatctcggcctactggatgggctac
cgcgagtacgccgccgccggccgcgcgaaccggacgcccgtgatgtggggcgtgcaggcg
gagggcgcggcgccgttcgtcaagggtgagccggtcgagcatcccgagacggtcgcgacg
gcgatccggatcggcaacccggcctcgtgggacctcgccgtcgccgcgcgggacgagagc
gggggccgcatcgacgccgtcagcgacgccgagatcctcgacgcgcaggcgctgatcgcg
cgcgaggtcggggtgttcgtcgaaccggcgtcggccgcgtcggtggccggactgctcgcc
cgcgcgcgggccggtgacgtgccggagagtgccaccatcgtgtgcacggtcacggggaac
gggttgaaggacacggcgacggcgctcggggacacgccgatcgcaccggtgagcgtgtcc
gcgcgaacggccgacgtcgcgcgggtgctcgggctggactga

DBGET integrated database retrieval system