KEGG   Beutenbergia cavernae: Bcav_1293Help
Entry
Bcav_1293         CDS       T00893                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bcv  Beutenbergia cavernae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bcav_1293
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bcav_1293
Enzymes [BR:bcv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bcav_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1467784..1469388)
Genome map
AA seq 534 aa AA seqDB search
MPELADPTALVPLPLHVETRPGTFRFGADAALVAEPAALDSAWLLQSYLLRAGVRGNVHG
VPAGEAAAGAVVLRVDDTCSDDAEGYRLVVAPDAVELVGASADGLARAVQTLRQLLPADA
LREGRRGGTPAMPCCVIEDTPRFRWRGVHLDVARHFMPVPFVLRFIDLAALHRLNVVHLH
LTDDQGWRLEVPSWPRLTEVSSWRDETVVGRHGLDTGFDGTPLGGFYTADDVREIVEFAR
RRRITVVPEVDLPGHVQSVLAAYPELGNTGERVDVRTTWGISDHVLAPTDEALTFARDVL
AVVADLFPSPWVHVGGDEVPRTEWRASPAAAERATALGLASVDELQSWFLRAIHADLTAR
GRRVVGWDEVLDDGGMPADTVVMAWRGVEHGLAGLAAGHDVVMCPKHVTYLDYASSSGED
EPLAPRRTITLEDIAAWEPEPPGSADLPGRILGVQGQLWTEYMPTPRDVEYMAFPRLAAL
AEAGWTSAKRREAADLLDRMPGHLRRLDALGVNYRPLAGPHPWQRGGTGRRRRL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagctcgcggacccgaccgccctcgtccccctgccactgcacgtcgagaccagg
ccggggaccttccggttcggcgccgacgccgcgctcgtcgccgaacccgcagccctggac
tccgcctggctcctgcagtcctacctgctgcgtgccggtgtgcgcgggaacgtccacggg
gtccccgccggggaggccgccgcaggggcggtggtcctccgggtggacgacacctgctcg
gacgacgccgaggggtaccggctcgtggtggcgcccgacgccgtcgagctggtcggtgcg
tccgcggacgggctcgcccgcgccgtccagacgctccgacagctgctgccagccgatgcg
ctgagggagggccggcgcggcgggacgcccgcaatgccgtgctgcgtcatcgaggacacg
ccccggttccgctggcggggcgtccacctcgacgtcgcacgccacttcatgcccgtcccg
ttcgtgctgcggttcatcgatctcgcggcgctgcaccggctgaacgtcgtgcacctgcac
ctgaccgacgaccagggatggcggctggaggtgccgtcatggccccggctcaccgaggtg
tcgtcctggcgcgacgagacggtggtcggtcgccacggcctcgatacgggcttcgacggc
acaccgctcggtggcttctacacggcggacgacgtccgcgagatcgtcgagttcgcccgg
cgacgccggatcaccgtggtgccggaggtggaccttcccggccacgtgcagtccgtgctc
gccgcctatccggagctcggcaacaccggcgagcgggtcgatgtgcgcaccacctggggc
atctcggaccacgtcctcgccccgaccgacgaggcgctgacgttcgcgcgggacgtgctc
gccgtcgtcgccgacctgttcccgagtccgtgggtccacgtcggcggcgacgaggtgccg
cgcaccgagtggcgcgcgagtccggcggcggcagaacgtgccacggcgctcgggctggcg
tcggtggacgagctgcagagctggttcctccgcgcgatccacgccgacctcaccgctcgc
ggccggcgcgtcgtcggctgggacgaggtgctcgacgacggcgggatgcccgccgacacg
gtggtcatggcgtggcgcggggtcgagcacgggctggcgggcctcgccgccgggcacgac
gtcgtcatgtgcccgaagcacgtgacctacctcgactacgcctcctcgagcggcgaggac
gaacctctcgcgccgcgccggacgatcacgctcgaggacatcgccgcctgggagccggag
cctccggggtccgcggaccttcccggtcgcatcctcggcgtgcagggccagctctggacg
gagtacatgccgacgccgcgcgacgtcgagtacatggcgttcccgcggctcgccgcgctc
gccgaggcggggtggacgtcggcgaagcggcgtgaggcggcggatctgctggaccggatg
cccggacacctgcggcggctcgacgctctcggtgtcaactaccgcccgctcgcgggaccg
cacccgtggcagcgcggcgggacggggcggcgtcgccggctctga

DBGET integrated database retrieval system