KEGG   Beutenbergia cavernae: Bcav_1334Help
Entry
Bcav_1334         CDS       T00893                                 

Definition
1,4-alpha-glucan branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bcv  Beutenbergia cavernae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcav_1334
Enzymes [BR:bcv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Bcav_1334
Exosome [BR:bcv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcav_1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1516492..1518723)
Genome map
AA seq 743 aa AA seqDB search
MSTEPATPSPAPVEPSRLRAVARGESPTPHDVLGAHLAPSSDGTQTVVTVRTRRPLADDV
AVLVGDERHPARHELEGVWVAAFTAPDGEAVPDYRVEVTYGEATQVVDDPYRFLPTLGDV
DLHLIGEGRHERLWEALGAHVQRFDSVRGEVRGTSFAVWAPNARAVRVVGDFNGWDGTGS
SMRSLGASGVWEVFLPGVGAGARYKFEILTGAGTWHQKADPLARATQVPPETASVVTESS
YTWSDDDWLEGRAAADAHTGPMSVYEVHLGSWKQGLDYRELAEQLVEYVTWLGFTHVELL
PVMEHPFGGSWGYQVTSYYAPTARFGDPDDLRYLIDRLHAAGIGVILDWVPAHFPKDDWA
LARFDGTSLYEDPDPLRGEQPDWGTYVFNFGRREVRNFLVANALYWLTEFHVDGLRVDAV
AAMLYLDYSRKPGEWRPNVRGGRENLEAIAFLQETNATAYRTAPGIVMIAEESTAFPGVT
TPTSAGGLGFGLKWNMGWMHDALTYLAQEPINRRYHHGELTFSLVYAFSEQFVLPLSHDE
VVHGKGSLYGKMPGDDWQRLAGVRALFAYQWSHPGKQLLFMGGEFAQVSEWAESRSLDWW
HLDDAGHRGVAELVRRLNAVYAARPALWRQDFTPHGFAWLEASDGDHNVLVYQRTAAATD
DDGADTVVVIVNFAGTPHEDYRVPLPHGGDWVELVNTDAAEYGGSGVGNLGKVRADAGPY
HGREHSALLRVPPLGALWLAPAP
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggagccggcgaccccgtcccccgccccggtcgagcccagcaggctgcgcgcc
gtcgcccgcggcgagtcgccgacaccccacgacgtgctcggcgcccacctggcgccgtcg
tcggacggcacccagaccgtcgtgaccgtccggacccgccgcccgctggccgacgacgtg
gcggtcctcgtgggtgacgagcgccacccggcccggcacgagctcgagggcgtctgggtc
gcggccttcaccgcgcccgacggcgaggcggttcccgactaccgcgtggaggtcacctac
ggggaggcgacgcaggtcgtcgacgacccgtaccgcttcctccccacgctcggcgacgtg
gacctgcacctcatcggcgagggcaggcacgaacgcctctgggaggcgctaggtgcgcac
gtccagcgcttcgactcggtgcggggcgaggtccgcgggacgtcgttcgccgtgtgggcg
ccgaacgcccgcgccgtccgcgtcgtcggcgacttcaacggctgggacggcaccggctcc
tcgatgcgttcgctcggggcctcgggcgtgtgggaggtgttcctgcccggtgtcggggcg
ggcgcgaggtacaagttcgagatcctgaccggtgccggcacctggcaccagaaggcggac
ccgctcgcccgcgccacccaggtcccgccggagacggcgtcggtcgtcaccgagtcgtcg
tacacctggtccgacgacgactggctcgagggccgagccgccgccgacgcgcacaccggc
ccgatgagcgtctacgaggtccacctcggctcgtggaagcaggggctcgactaccgcgag
ctcgccgagcagctcgtcgagtacgtgacgtggctggggttcacgcacgtcgagctgctc
ccggtgatggagcacccgttcggcgggtcgtgggggtaccaggtcacgtcgtactacgcg
ccgaccgcgaggttcggcgaccccgacgacctccgctacctcatcgaccggctccacgcg
gcgggcatcggcgtcatcctcgactgggtgccggcacacttccccaaggacgactgggcg
ctcgcccgcttcgacggcacgtccctgtacgaggaccccgacccgctccgcggcgagcag
ccggactggggcacgtacgtcttcaacttcggccggcgcgaggtgcgcaacttcctcgtc
gccaacgcgctgtactggctcacggagttccacgtcgacgggctccgcgtcgacgccgtg
gccgcgatgctctacctcgactactcacgcaagcccggcgagtggcggcccaacgtgcgc
ggcggccgggagaacctcgaggcgatcgcgttcctccaggagacgaacgcgacggcgtac
cgcaccgcccccgggatcgtgatgatcgccgaggagtcgacggcgttcccaggcgtcacg
acaccgacctcggcgggcggcctggggttcggcctcaagtggaacatgggctggatgcac
gacgcgctcacctacctcgcccaggagccgatcaaccggcgctaccaccacggcgagctg
acgttctcgctcgtgtacgcgttctcggagcagttcgtgctcccgctcagccacgacgag
gtcgtccacggcaagggctccctctacggcaagatgccgggcgacgactggcagcggctc
gcgggcgtccgggccctgttcgcctaccagtggtcgcaccccggcaagcagctgctgttc
atgggcggcgagttcgcgcaggtcagcgagtgggcggagtcccgcagcctggactggtgg
catctcgacgacgccggtcatcggggcgtcgcggagctcgtccgccggctcaacgccgtg
tacgcggcccgccccgcgctgtggcggcaggacttcaccccgcacggcttcgcgtggctc
gaggcgagcgacggcgaccacaacgtgctggtctaccagcggacggccgccgccacggac
gacgacggcgccgacaccgtcgtcgtgatcgtgaacttcgcgggcacgccgcacgaggac
taccgcgtcccgctcccccacgggggcgactgggtggagctcgtcaacaccgacgccgcc
gagtacggcggatccggcgtcgggaacctggggaaggtgcgcgccgacgccgggccgtac
cacgggcgggagcactcggccctcctgcgggtccccccgctcggcgcgctctggctggcg
cccgcgccctga

DBGET integrated database retrieval system