KEGG   Beutenbergia cavernae: Bcav_1505Help
Entry
Bcav_1505         CDS       T00893                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00030  Pentose phosphate pathway
bcv00051  Fructose and mannose metabolism
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01120  Microbial metabolism in diverse environments
bcv01130  Biosynthesis of antibiotics
bcv01200  Carbon metabolism
bcv01230  Biosynthesis of amino acids
Module
bcv_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bcv_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcav_1505
   00051 Fructose and mannose metabolism
    Bcav_1505
Enzymes [BR:bcv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Bcav_1505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB
Motif
Other DBs
NCBI-ProteinID: ACQ79761
UniProt: C5C362
Position
complement(1725579..1726049)
Genome map
AA seq 156 aa AA seqDB search
MAWRVVVGSDGAGFDYKEALKQDLFVSDLVSDVVDVGVPAADDGANYPSVAFEAARRVAA
GEADRALLVCGTGLGVAISANKVKGVRAVTAHDVYSVRRSVLSNDAQVLCLGQRVIGLEL
ARALTEEWLTLTFDPTSASAPKVAEIDTYEAGTGAC
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcgcgtggtggtgggctcggacggagccgggttcgactacaaggaggcgctc
aagcaggatctcttcgtgagcgatctggtgagcgacgtcgtggacgtcggagtacccgcc
gcggacgacggcgccaactatccgagcgtggcgttcgaggccgcgcgccgggtcgccgcg
ggcgaggcggaccgggcgctgctcgtgtgcggcacggggctcggcgtggcgatctccgcg
aacaaggtcaagggcgtccgggccgtcacggcgcacgacgtctactccgtgcggcggtcg
gtgctgtcgaacgacgcccaggtgctctgcctcggccagcgggtgatcgggctggagctc
gcgcgcgccctcaccgaggagtggctgacgctgacgttcgacccgacgtcggcgtccgcg
ccgaaggtggcggagatcgacacgtacgaggccgggaccggggcgtgctga

DBGET integrated database retrieval system