KEGG   Beutenbergia cavernae: Bcav_1549Help
Entry
Bcav_1549         CDS       T00893                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K20905  
L-erythrulose 4-phosphate epimerase [EC:5.1.3.39]
Organism
bcv  Beutenbergia cavernae
Brite
Enzymes [BR:bcv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.39  L-erythrulose 4-phosphate epimerase
     Bcav_1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1778062..1778805
Genome map
AA seq 247 aa AA seqDB search
MTSTWVGTSWKMTKTLAEARAFARGLAAAEPALPAEVQPFVIPPATALAAVRAELPASSR
VLVGAQDAHWEDAGPWTGEVSVPQVADAGARLVEIGHSERREAFGETDERIRLKVHATLR
HSLVPLVCVGEPAAVRAAGGQAAYVAAQTRAAFDGVAAGTRVLVAYEPVWAIGEGGRPAT
PDDVEAPVAAIRAATADLDAHVLYGGSVDGENAPALLDVPGVGGLFVGRAAWDLAGFLTI
LRVAARG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgactagcacctgggtcggcaccagctggaagatgacgaagacgctcgccgaggcgcgc
gcgttcgcgcgcgggctcgccgcagcggagcccgcgctgccggcggaggtccagccgttc
gtcatcccgcccgcgacggcgctcgccgccgtccgcgcggagctcccggcgtcctcgcgc
gtgctcgtgggggcgcaggacgctcactgggaggacgccgggccgtggacgggcgaggtg
tcggtgccccaggtggccgacgccggggcgaggctcgtggagatcggccactcggagcgt
cgcgaggcgttcggtgagacggacgagcggatccggctcaaggtgcacgccacgttgcgc
cactccctggtgccgctcgtgtgcgtgggggagccggccgccgtccgggccgccggcggg
caggccgcctacgtcgcggcgcagacgcgagcggcgttcgacggcgtcgcggcgggcacg
cgcgtgctggtcgcgtacgagccggtgtgggcgatcggcgagggcgggcggccggccacg
ccggacgacgtcgaggcgccggtcgcggcgatccgggcggcgaccgccgacctcgacgcc
cacgtgctctacggcggctcggtggacggcgagaacgcgccggcgctgctggacgtgccc
ggcgtcggcgggctgttcgtcgggcgcgccgcatgggacctcgcgggcttcctcacgatc
ctccgggtcgccgcgcgcggctga

DBGET integrated database retrieval system