KEGG   Beutenbergia cavernae: Bcav_1610Help
Entry
Bcav_1610         CDS       T00893                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bcv  Beutenbergia cavernae
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Bcav_1610
Enzymes [BR:bcv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Bcav_1610
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Bcav_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1851797..1852729
Genome map
AA seq 310 aa AA seqDB search
MPELPEVETVRAGLAAHALGRRIVRVDVAGERTTRRQAGGALALVDALEGASFTAAVRRG
KFCWLTLDTGRALLVHLGMSGQLLVRGAGQDAQDDPRHLRARIRFADDGELLFIDQRTFG
YLTSSDLVPTADGGPGGFGSDDPRLPLEVAGIARDLLDPALRIDELVTAVRTRRSAVKRA
LLDQSLVSGVGNIYADEALWRARVHPERATRGLPRLAVRSVLESAAGVMQDALAQGGTSF
DALYVDVNGASGYFDRSLSVYGQTGRPCPRCGTAIVRSEFMNRSSHWCPTCQPAPRGAAR
PVDRGAAARR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagcttcccgaggtcgagacggtccgcgccgggctcgccgcccatgcgctgggt
cgccggatcgtccgcgtcgatgtcgccggcgagcgcacgacgcggcgccaggccggcggt
gccctcgcgctcgtggacgcgctcgagggcgcctcgttcaccgctgccgtgcggcgcggg
aagttctgctggctcaccctcgacaccggacgcgccctcctcgtccacctcgggatgagc
ggccagctgctcgtccgcggtgccggccaggacgcgcaggacgacccgcggcacctgcgc
gcccggatccggttcgccgacgacggcgagctgctcttcatcgaccagcgcaccttcggg
tacctcacgtcgtcggacctcgtgccgaccgctgacggcggcccgggcgggttcggcagc
gacgatccgcggctcccgctcgaggtcgccggcatcgcccgcgacctgctcgacccggcc
ctgcgcatcgacgagctggtgaccgccgtgcgcacccgccggagcgccgtcaagcgcgcg
ctgctcgaccagtcgctcgtgtcgggagtcgggaacatctacgccgacgaggcgctgtgg
cgcgcccgggtgcatccggagcgcgccactcgcggcctgccgcgcctggcggtgcgctcg
gtgctggagtccgccgccggggtcatgcaggacgcgctggcgcagggcggcacgagcttc
gacgccctgtacgtcgacgtcaacggcgcgagcgggtacttcgaccggtcgctctccgtg
tacgggcagacgggccggccgtgcccccggtgcggcacggcgatcgtgcggtccgagttc
atgaaccggtcctcgcactggtgcccgacgtgccagccggccccgcggggcgccgcgcgt
cccgtcgaccgaggagcggccgcgcgtcgatag

DBGET integrated database retrieval system