KEGG   Beutenbergia cavernae: Bcav_1625Help
Entry
Bcav_1625         CDS       T00893                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00330  Arginine and proline metabolism
bcv00332  Carbapenem biosynthesis
bcv01100  Metabolic pathways
bcv01130  Biosynthesis of antibiotics
bcv01230  Biosynthesis of amino acids
Module
bcv_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bcav_1625
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Bcav_1625
Enzymes [BR:bcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Bcav_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA E3_binding STAS
Motif
Other DBs
NCBI-ProteinID: ACQ79881
UniProt: C5C3W8
Position
1870506..1871645
Genome map
AA seq 379 aa AA seqDB search
MSVDSELTRAGLPQAHRIVVKVGSSSLTEGGGSLDVAALRALVEVFAARRRSGGQVVLVS
SGAIAAGIAPLGLSSRPRDLATQQAAASVGQGLLMAHYTQAFAQHGLRVAQVLLTAEDVV
RRGQYKNAQRALERLLALGVVPIINENDAVATDEIRFGDNDRLAALVSHVVQADALVLLT
DVDALYDAPPASPLARRIARVRTARELDEVAVTGRGSGVGTGGMVTKVEAAAIATGAGIP
TLVAAASQAGRALDGDDVGTWFDARGRRIRTRRLWLAHAAHTRGRLQLDDGAVRAITHGK
RSLLAAGVTGVEGHFEPGDPVDLVAPTGEIVARGLVAYSSEELPERLGRSSHELRELFGD
GHNRTVVHRDDLVVVHRRA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcgacagcgagctcacgcgggccggcctgccgcaggcgcaccggatcgtcgtc
aaggtcggctcctcgtcgctgaccgagggcggcggctcgctcgacgtcgcggccctgcgc
gccctcgtggaggtgttcgcggcccgacgtcggagcggcgggcaggtcgtcctcgtgtcg
tcgggcgcgatcgccgcgggcatcgcgcccctcgggctcagcagccggccccgggatctc
gcgacgcagcaggccgccgcgagcgtgggtcagggcctgctcatggcgcactacacccag
gcgttcgcccagcacgggctccgcgtggcacaggtgctgctcaccgcggaggacgtggtc
cggcgcgggcagtacaagaacgctcagcgcgcgctcgagcgcctgctcgcgctcggggtc
gtgccgatcatcaacgagaacgacgccgtcgccaccgacgagatccggttcggcgacaac
gaccgtctcgcggcgctcgtctcgcacgtggtgcaggccgacgcgctcgtcctgctcacc
gacgtcgacgccctgtacgacgcgcctccggcgtcgcccctcgcgcggcgcatcgcccgc
gtgcggacggcgcgggagctcgacgaggtcgccgtcaccggccgggggagcggcgtcggc
accggcgggatggtcacgaaggtcgaggcggcggcgatcgcgaccggtgcgggcatcccg
acgctcgtggccgccgcgtcgcaggcgggccgggcgctcgacggcgacgacgtcggcacg
tggttcgacgcccgcgggcgccggatccgcacccgccggctgtggctcgcgcacgcggcc
cacacccgggggcgcctgcagctggacgacggcgccgtgcgcgcgatcacgcacggcaag
cggtcgctgctcgccgccggcgtgaccggtgtcgagggccacttcgaaccgggcgacccg
gtcgacctcgtggcgccgaccggcgagatcgtcgcccgcggcctcgtggcctactcgagc
gaggagctcccggaacgcctggggcgcagctcgcacgagctccgcgagctgttcggcgac
gggcacaaccggacagtcgtgcaccgcgacgacctcgtcgtcgtccatcgccgcgcctga

DBGET integrated database retrieval system