KEGG   Beutenbergia cavernae: Bcav_1705Help
Entry
Bcav_1705         CDS       T00893                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcv  Beutenbergia cavernae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcav_1705
Enzymes [BR:bcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bcav_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1951687..1952637
Genome map
AA seq 316 aa AA seqDB search
MSASRGRVCVVGSFMMDLVVSAPRRPRPGETLVGTSFAQYVGGKGFNQAVAASRAGAATS
FVGRLGDDLFGAEFRAALRTDGIDDGGVLDDAEGGTGVGLPVVEPGGQNSIIIVPRANLR
LTPADVERSRERIEAADVLLLQLEVPVEASLAAARIARGAGTAVVLNPAPYAPLPPELVA
ACDLLVPNEHELAGLAGAPVPADGPEAVEVLARDVLGRHGVSLVVTMGATGVLVLAADGA
SSLVPGRTVEAVDTVGAGDTFCGNLGARLAVGDALTDAVAYANAAASIAVTRHGGAPSAP
EADEVEAVRRHLEIAG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgtcgcgcggccgcgtctgcgtggtcgggtcgttcatgatggacctcgtcgtc
tcggcgccccgccgcccgcggccgggggagacgctcgtcgggacgtccttcgcgcagtac
gtcggaggcaaggggttcaaccaggccgtggccgcctcccgggccggcgcggcgacgtcg
ttcgtcggccgcctgggcgacgacctgttcggtgccgagttccgcgcggcgcttcgtacc
gacggcatcgacgacggcggcgtgctcgacgacgccgagggcggcaccggcgtcggcctc
cccgtggtcgagccgggcgggcagaactccatcatcatcgtgccgcgcgcgaacctgcgg
ctgacgcctgccgacgtcgagcgttcgcgggagcgcatcgaggcggccgacgtcctgctc
ctgcagctggaggtgccggtggaggcctcgctggccgcggcccggatcgcccggggagcc
ggcaccgccgtcgtgctcaacccggcgccgtacgcgccgctgccgcccgagctcgtcgcc
gcctgcgacctgctggtcccgaacgagcacgagctcgccgggctggcgggggcgccggtg
ccggcggacggacccgaggcggtggaggtgctcgcgcgcgacgtgctcggccgccacggc
gtctccctcgtcgtgacgatgggtgcgacgggggtgctcgtgctcgccgccgacggcgcg
tcgagcctcgtgcccggccgcaccgtcgaggccgtcgacacggtgggcgccggcgacacg
ttctgcggcaacctcggcgcgcggctggccgtcggtgacgcactgacggacgccgtcgcg
tacgcgaacgccgcggcgtccatcgccgtcacgcggcacgggggtgcgccgtccgctccg
gaggccgacgaggtcgaggcggtccgtcgacacctcgagatcgcgggctga

DBGET integrated database retrieval system