KEGG   Beutenbergia cavernae: Bcav_1845Help
Entry
Bcav_1845         CDS       T00893                                 

Definition
ROK family protein (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
bcv  Beutenbergia cavernae
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcav_1845
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcav_1845
   00520 Amino sugar and nucleotide sugar metabolism
    Bcav_1845
Enzymes [BR:bcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Bcav_1845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2104612..2105379)
Genome map
AA seq 255 aa AA seqDB search
MSKKTKSKVAFGIDVGGSGIKGAPVDLERGDFAADRVRIATPEPSTPDAVASVFTDLVAR
FDLPDDAAVGVTFPAIIRRGVAFSAANVDPGWIGTDIAKVVKKATGHRAVVVNDADAAGY
AEVVYGAAKGKDGLVIVLTLGTGIGSAMIYDGVLVPNSELGHLEIDGHDAETQASSGVKD
REGWSYEEWIPRLQRYFDVVEFLFSPDLFVVGGGVSKDHEKFLPFLKLHTPIVPAKLRNR
AGIVGAAALAAKASE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagacgaagtcgaaggtcgcgttcgggatcgacgtcggcgggtccggcatc
aagggggctccggtcgacctggaacgcggggacttcgccgccgaccgtgtgcgcatcgcc
accccggagccgtccacgccggacgccgtcgcgtccgtcttcacggatctcgtcgcgcgg
ttcgacctcccggacgacgccgctgtgggcgtgacgttcccggcgatcatccggcgcggc
gtggcgttctccgccgcgaacgtcgacccggggtggatcgggacggacatcgcgaaggtc
gtgaagaaggccaccggacaccgcgccgtcgtcgtcaacgacgccgacgccgccgggtac
gcggaggtcgtgtacggcgcggcgaagggcaaggacggactcgtcatcgtgctcacgctc
ggcacgggcatcgggagcgcgatgatctacgacggcgtcctcgtgccgaactccgagctc
gggcacctcgagatcgacggtcacgacgccgagacgcaggcctcgagcggcgtgaaggac
cgcgaggggtggagctacgaggagtggatcccgcgcctgcagcggtacttcgacgtcgtc
gagttcctgttctcgccggacctgttcgtggtcggcggcggggtgagcaaggaccacgag
aagttcctcccgttcctcaagctccacacgccgatcgttccggcgaagctgcgcaaccgt
gccgggatcgtcggagccgcggctctcgcggccaaggcgagcgagtga

DBGET integrated database retrieval system