KEGG   Beutenbergia cavernae: Bcav_1845Help
Entry
Bcav_1845         CDS       T00893                                 

Definition
ROK family protein (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
bcv  Beutenbergia cavernae
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:bcv01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bcv00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bcv00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2104612..2105379)
Genome map
AA seq 255 aa AA seqDB search
MSKKTKSKVAFGIDVGGSGIKGAPVDLERGDFAADRVRIATPEPSTPDAVASVFTDLVAR
FDLPDDAAVGVTFPAIIRRGVAFSAANVDPGWIGTDIAKVVKKATGHRAVVVNDADAAGY
AEVVYGAAKGKDGLVIVLTLGTGIGSAMIYDGVLVPNSELGHLEIDGHDAETQASSGVKD
REGWSYEEWIPRLQRYFDVVEFLFSPDLFVVGGGVSKDHEKFLPFLKLHTPIVPAKLRNR
AGIVGAAALAAKASE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagacgaagtcgaaggtcgcgttcgggatcgacgtcggcgggtccggcatc
aagggggctccggtcgacctggaacgcggggacttcgccgccgaccgtgtgcgcatcgcc
accccggagccgtccacgccggacgccgtcgcgtccgtcttcacggatctcgtcgcgcgg
ttcgacctcccggacgacgccgctgtgggcgtgacgttcccggcgatcatccggcgcggc
gtggcgttctccgccgcgaacgtcgacccggggtggatcgggacggacatcgcgaaggtc
gtgaagaaggccaccggacaccgcgccgtcgtcgtcaacgacgccgacgccgccgggtac
gcggaggtcgtgtacggcgcggcgaagggcaaggacggactcgtcatcgtgctcacgctc
ggcacgggcatcgggagcgcgatgatctacgacggcgtcctcgtgccgaactccgagctc
gggcacctcgagatcgacggtcacgacgccgagacgcaggcctcgagcggcgtgaaggac
cgcgaggggtggagctacgaggagtggatcccgcgcctgcagcggtacttcgacgtcgtc
gagttcctgttctcgccggacctgttcgtggtcggcggcggggtgagcaaggaccacgag
aagttcctcccgttcctcaagctccacacgccgatcgttccggcgaagctgcgcaaccgt
gccgggatcgtcggagccgcggctctcgcggccaaggcgagcgagtga

DBGET integrated database retrieval system