KEGG   Beutenbergia cavernae: Bcav_1862Help
Entry
Bcav_1862         CDS       T00893                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcv  Beutenbergia cavernae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcav_1862
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcav_1862
  Amino acid metabolism
   00310 Lysine degradation
    Bcav_1862
Enzymes [BR:bcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bcav_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2124111..2125991)
Genome map
AA seq 626 aa AA seqDB search
MSETVKMPALGESVTEGTVTRWLKAVGDTVAVDEPLLEVSTDKVDTEIPSPIAGVLQKIL
AEEDDTVEVGADLAVIGADAEAASDEGAPEAPAAEGQAEAAPEAGAEAPAEEAPQQAAEE
QPPAPEPAPEPEQAAPAEESAPAPAAQAEQPAAAASAEAGTDVTLPALGESVTEGTITRW
LKAVGDEIAVDEPLLEVSTDKVDTEIPSPVAGTVLEILAAEDETVEVGAVLARVGAAAPE
AKAPEPEPQAAPEPEPAAAEPEEAKAEPSAAEPEQAAAPEPEPAPAAPAPAPAAAAPAAT
TPEPAPRPSAAEALSGTSTTYVTPLVRKLAGQHGVDLEGLTGTGVGGRIRKQDVLDAAEA
AKAAAAAPAAAAPAAPAGPAATVLPVSPLRGTREKMSRLRKIVAQRMVESLQVSAQLTTV
VEVDVTRIARLRDRAKADFATREGAKLTYLPFFALATTEALKAYPKLNASIEGEEIVYHG
AENVGIAVDTDRGLVVPVVKDAGDLNIAGFARKIADLASRTRANKAVPDELSGGTFTLTN
TGSGGALFDTPILLQPQVGILGIGTIVKRPMVVKDADGAEVIAVRSMVYLALSYDHRLVD
GADAGRFLTAIKNRLEEGAFESDLGL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaaccgtcaagatgccggccctcggtgagagcgtgaccgagggcacggtcacc
cggtggctcaaggccgtgggagacacggtggcggtcgacgagccgctgctggaggtctcg
accgacaaggtggacaccgagatcccgtcgccgatcgcgggcgtgctgcagaagatcctc
gcggaggaggacgacaccgtcgaggtcggcgccgacctcgccgtcatcggagccgacgcc
gaggcagcgtccgacgagggcgctcccgaggctcccgccgccgagggccaggccgaggct
gcgcccgaagcaggggccgaagcaccggccgaggaggccccgcagcaggccgccgaggag
cagccgccggcaccggagcccgcccccgagccggagcaggccgctcccgcggaggagtcg
gctcccgcacccgccgcccaggccgagcagcccgccgcggcggcgtccgccgaggccggt
accgacgtcacgctgcccgctctgggcgagagcgtcaccgagggcacgatcacgcggtgg
ctcaaggccgtcggtgacgagatcgccgtcgacgaacccctgctcgaggtctcgaccgac
aaggtcgacacggagatcccgtcgcccgtcgccggcaccgtcctcgagatcctcgccgcg
gaagacgagacggtcgaggtcggagcggtgctcgcgcgggtcggcgcggccgcgcccgag
gcgaaggccccggagcccgagccgcaggcagcgccggagccggagccggctgcagcggag
cccgaggaggccaaggcggagccctccgcagcggagccggagcaggccgcggcccccgag
cccgagcccgccccggcggcaccagcccccgcgccggcggccgcggcaccggcggcgacg
acgcccgaacccgctccccgtccgagcgccgccgaggcgctctccggcacgagcaccacg
tacgtcaccccgctcgtgcgcaagctggcggggcagcacggggtcgacctcgaagggctc
accggcacgggcgtcggcgggcggatccgcaagcaggacgtgctcgacgccgccgaggcc
gcgaaggccgcggctgctgccccggccgcggcagctcccgccgctccggccggcccggcc
gcgacggtgcttcccgtctccccgctccggggaacgcgcgagaagatgtcgcgcctgcgc
aagatcgtcgcgcagcgcatggtcgagtcgctccaggtgtcggcccagctcaccacggtg
gtcgaggtggacgtcacccgcatcgctcgactgcgggaccgtgcgaaggcggacttcgca
acccgtgagggtgcgaagctcacctacctcccgttcttcgcgctcgccaccaccgaggcg
ctcaaggcctacccgaagctcaacgcgagcatcgagggcgaggagatcgtctaccacggt
gccgagaacgtcgggatcgccgtcgacacggaccgcggcctcgtggttcccgtggtcaag
gacgccggagacctgaacatcgccggcttcgcccgcaagatcgccgacctcgcgtcccgg
acccgcgccaacaaggccgtgccggacgagctcagcggcggcacgttcacgctgacgaac
acgggcagcggcggtgccctgttcgacacgccgatcctcctgcagccgcaggtcggcatc
ctcggcatcggcacgatcgtcaagcggccgatggtcgtgaaggacgccgacggcgccgag
gtgatcgccgtgcggtcgatggtgtacctcgcgctgagctacgaccaccggctcgtcgac
ggcgcggacgcgggtcgcttcctcaccgccatcaagaaccgcctcgaggagggcgcgttc
gagtccgacctcgggctctga

DBGET integrated database retrieval system