KEGG   Beutenbergia cavernae: Bcav_1902Help
Entry
Bcav_1902         CDS       T00893                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bcv  Beutenbergia cavernae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcav_1902
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcav_1902
   00052 Galactose metabolism
    Bcav_1902
   00500 Starch and sucrose metabolism
    Bcav_1902
   00520 Amino sugar and nucleotide sugar metabolism
    Bcav_1902
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcav_1902
   00524 Butirosin and neomycin biosynthesis
    Bcav_1902
Enzymes [BR:bcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bcav_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2167475..2168413
Genome map
AA seq 312 aa AA seqDB search
MHAIGVDIGGTKIAAGVVDPDGNVLRLVRHGTSSDDPAEIERAVVDAVQELRAEHEVGAV
GVAAAGFVDAERSRVRFAPNIAWRDHALRDSLATHIDLPIVVENDANAAGWAEFRFGAGR
DAEHMVLLTVGTGLGGAIVTGGSLLRGAFGAAGEVGHMQLVPDGQLCGCGHAGCWEQYAS
GRALVRDTKAALVTTPERADALLRLAGGDPEDVTGPHVTEAARAGDPLALELLEDLGAAL
GTGIADLAALLDPEVVVVGGGVADAGDLLLAPARRAFTEQLFARGFRPEPVIVTARLGND
AGVVGVADLARG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccatcggggtggacatcggcgggacgaagatcgcggccggggtcgtggacccc
gacgggaacgtcctccgcctcgtccgccacgggacgagctccgacgacccggccgagatc
gagcgcgcggtcgtcgacgcggtccaggagctgcgcgcggagcacgaggtcggggcagtc
ggggtcgccgccgccgggttcgtcgacgccgagcgttcccgcgtccggttcgcgcccaac
atcgcgtggcgggaccacgcgctgcgcgactcgctcgccacacacatcgacctgccgatc
gtcgtcgagaacgacgccaacgccgcggggtgggccgagttccggttcggcgccggccgc
gatgccgagcacatggtgctgctgacggtagggaccggtctgggcggggcgatcgtcacg
ggcggctcgctcctgcgcggtgcgttcggcgccgccggcgaggtggggcacatgcagctc
gtgcccgacggtcagctgtgcggctgcgggcacgccggatgctgggagcaatacgcgtcg
ggacgcgcgctcgtgcgcgacacgaaggccgctctcgtgacgacgccggagcgggccgac
gcgctgctccgcctcgcgggcggcgatcccgaggacgtcaccggcccgcacgtcaccgag
gccgcacgcgccggggacccgctggcgctcgagctcctcgaggacctgggggcggcgctc
ggcacggggatcgcggacctggcggctctgctcgacccggaggtcgtggtcgtggggggc
ggcgtggcggacgccggggacctgctgctcgcgcccgcccgccgggcgttcaccgagcag
ctgttcgcccgtggcttccggccggagcccgtcatcgtcaccgcacggctgggcaacgac
gccggcgtggtcggcgtcgcagacctggcccgcggatag

DBGET integrated database retrieval system