KEGG   Beutenbergia cavernae: Bcav_1993Help
Entry
Bcav_1993         CDS       T00893                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bcv  Beutenbergia cavernae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bcv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2270623..2271225
Genome map
AA seq 200 aa AA seqDB search
MIALVQGRVAAIGLDAVVVVVGGVGMRVLATPATLAGLRVEADCELHTSLVVREDSLTLF
GFADADERDVFELVQTVSGVGPRLALAMLAVHTPDGLRRAVAQEDLAALVRVPGIGRKGA
SRIVLELGDRLGPAQGAAPAAPVAVDDGADVVDALVGLGWPVRQAQDAVRGVLEDADGTA
PDAAGLLRAALRSLAGDARG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgctggtgcagggccgggtggccgccatcgggctcgacgccgtcgtcgtggtc
gtcggaggtgttgggatgcgcgtgctggccacgccggcgacgctggccgggctgcgcgtc
gaggccgactgcgagctgcacacgtcgctcgtcgtccgggaggactcgctcaccttgttc
ggcttcgcggacgccgacgagcgcgacgtgttcgagctcgtgcagacggtgtccggcgtc
ggcccgcgtctcgcgctggcgatgctcgccgtgcacacgccggacggtctgcggcgcgcc
gtcgcccaggaggacctggcggcactcgtgcgtgtccccgggatcggccggaagggcgcg
agccgcatcgtcctcgagctgggcgaccggctcgggcccgcccagggtgcggctccggcg
gctcctgtggccgtggacgacggcgcggacgtcgtcgacgcgctggtgggcctcgggtgg
cccgtgcggcaggcgcaggacgccgtccgcggcgtgctcgaggacgccgacggcacggcc
ccggacgcggcgggcctgctccgggccgcgctgcggtcgctcgccggggacgcccgtggc
tga

DBGET integrated database retrieval system