KEGG   Beutenbergia cavernae: Bcav_2034Help
Entry
Bcav_2034         CDS       T00893                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bcv  Beutenbergia cavernae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bcv00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bcv00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2313394..2314392
Genome map
AA seq 332 aa AA seqDB search
MRHLLSAADLGRDEAVALLDTAETMADTQSRAIKKLPPLRGLTVVNLFFEDSTRTRISFE
AAAKRLSADVINFSAKGSSVSKGESLKDTAQTLQAMGADAVVVRHWASGAPHRLAHAGWI
AAPVINAGDGTHQHPTQALLDAFTLRRRLAGPDGPIGTDLAGRHVVVVGDVLHSRVARSN
VDLLSTLGARVTLVAPPTLLPVGVESWPCEVGYDLDAAIDAGPDAVMMLRVQRERMSSGF
FPSEREYARAYGLDAARVSRLGKHALVMHPGPMNRGLEISADAADSARSTVVEQVTNGVS
VRMAVLYTLLAGGPDGDSTTSPGSGPEGGTTP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacctgctgtccgccgcggacctcgggcgcgacgaggccgtcgccctgctcgac
accgcggagacgatggccgacacgcagtcgagagccatcaagaagctgcccccgctgcgc
ggcctcaccgtggtcaacctgttcttcgaggactccacgcggacccggatctcgttcgag
gcggccgcgaagcggctctcggcggacgtcatcaacttctccgcgaaggggtccagcgtc
tccaagggggagtcgctcaaggacacggcgcagacgctgcaggcgatgggggcggacgcc
gtcgtcgtccgccactgggcctcgggcgcgccgcaccggctcgcgcacgcaggctggatc
gccgccccggtcatcaacgccggcgacggcacccaccagcacccgacgcaggccctgctc
gacgcgttcacgctgcgccgtcgcctcgccggtcccgacgggcccatcgggaccgatctc
gccgggcggcacgtcgtcgtcgtcggcgacgtcctgcactcccgcgtcgcccgctcgaac
gtcgacctgctcagcacgctcggcgcccgcgtgacgctcgtcgccccgccgacgctgctg
ccggtcggcgtcgagagctggccgtgcgaggtgggctacgacctcgacgccgcgatcgac
gccggacccgacgccgtcatgatgctgcgcgtccagcgggagcggatgagctccgggttc
ttcccgtccgagcgcgagtacgcgcgggcctacgggctcgacgccgcccgcgtgtccagg
ctcgggaaacacgcgctcgtcatgcatcccggaccgatgaaccgagggctcgagatctcg
gccgacgcggcggactccgcccgctcgactgtcgtcgagcaggtcacgaacggcgtctcc
gtgcggatggccgtcctgtacacgctgctcgcgggcggccccgacggcgactcgaccacc
agcccgggctccggcccggagggaggcaccactccatga

DBGET integrated database retrieval system