KEGG   Beutenbergia cavernae: Bcav_2111Help
Entry
Bcav_2111         CDS       T00893                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcv  Beutenbergia cavernae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcav_2111
   00052 Galactose metabolism
    Bcav_2111
   00500 Starch and sucrose metabolism
    Bcav_2111
   00520 Amino sugar and nucleotide sugar metabolism
    Bcav_2111
Enzymes [BR:bcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bcav_2111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2380702..2382087)
Genome map
AA seq 461 aa AA seqDB search
MSDQGLDLARTRMAEAAVPALAIDTFARLYRELERGESGMLAERDVAPLVDVEHADALET
ADAGALARTVMIKLNGGLGTSMGMDRAKSLLPVRGEATFLDVIAEQVLAARARHGVPLPL
VLMNSFRTRDDSLAALARHRDLAVDGIPSDFLQNREPKLRADDLTPVTWPADPELEWCPP
GHGDLYTALQTSGLLERLLDAGYRYASVSNADNLGAVPDAGIAAWFAASGAAFAAEVARR
TPADRKGGHVVVRRSDSRLVLRETAQTRQQDRAAASDITRHKYFNTNNLWLDLAALADLL
AERDGVLPLPLISNAKTVDPADPDSTPVIQLETAMGAAIEVFDGARVLEVNRSRFLPVKT
TDDLLLVRSDVYALDDDARLVARVAAPFVELDSPYRLLAGFDARFPAGPPSLVDATSLRV
RGDWTFGARVRVVGDAVLSADDGAARRVPDGALVSERGAGR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccaggggctggacctcgcccgtacccggatggcggaggccgctgtgcctgcc
ctcgcgatcgacaccttcgcgcgtctctaccgcgagctcgaacgtggcgagagcgggatg
ctcgcggaacgcgacgtcgccccgctcgtcgacgtcgagcatgccgacgccctcgagacc
gccgacgcgggagcgctcgcccggaccgtgatgatcaagctcaacggcgggctcggcacg
tcgatgggcatggaccgggcgaagtcgctgctcccggtccgcggcgaggccacgttcctc
gacgtcatcgcggagcaggtgctggcggcgcgggcgcggcacggcgtcccgctcccgctc
gtgctcatgaacagcttccgcacccgtgacgactcgctcgccgcactggcccggcaccgc
gacctcgccgtcgacggcatcccctccgacttcctgcagaaccgggagccgaagctgcgc
gccgacgacctcacgccggtgacgtggcccgccgaccccgagctcgagtggtgcccgccg
gggcacggcgacctgtacacggcgctgcagacctccggcctgctggaacggttgctcgac
gccggctaccgctacgcgagcgtgtccaacgccgacaacctgggagccgtgcccgacgcc
gggatcgccgcgtggttcgcggcgtcgggggcggcgttcgccgccgaggtcgcgcgccgc
acgcccgccgaccggaagggcgggcacgtcgtcgtccggcgcagcgacagccgactcgtg
ctgcgcgagacggcgcagacccggcagcaggaccgtgccgcggcgtccgacatcacccgg
cacaagtacttcaacaccaacaacctgtggctcgacctggccgcgttggccgacctgctc
gcggagcgtgacggcgtcctgccgctgccgctcatcagcaacgcgaagaccgtcgacccg
gccgaccccgactcgacgccggtgatccagctcgagaccgccatgggggcggcgatcgag
gtgttcgacggcgcccgcgtgctggaggtgaaccggtcgaggttccttccggtgaagacg
actgacgacctgctcctcgtccggtcggacgtgtacgcgctggacgacgacgcccggctc
gtcgcccgtgtcgcggcaccgttcgtcgagctggactcgccgtaccggctgctcgccggg
ttcgacgcacgcttcccggccggccctccgtcgctcgtggacgcgacgtccctgcgggtg
cgcggggactggacgttcggggctcgcgtacgggtggtcggcgacgcggtgctctccgcc
gacgacggcgcggcgcggcgggtgcccgacggcgcgctcgtctccgagcgcggggccggg
cgctga

DBGET integrated database retrieval system