KEGG   Beutenbergia cavernae: Bcav_2162Help
Entry
Bcav_2162         CDS       T00893                                 

Definition
transaldolase
Orthology
K00616  
transaldolase [EC:2.2.1.2]
Organism
bcv  Beutenbergia cavernae
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:bcv01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcv01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bcv00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2434092..2435243
Genome map
AA seq 383 aa AA seqDB search
MQSNDRLERISASGVSIWLDDLSRDRLDTGELAELVSTSHVVGVTTNPTIFAAALQDGDA
YADQVGDLAARGIGAEEAAIALTSDDVRSATAVLAPLYTASGFQDGRVSIEVDPRLARDT
EETIAQARRLWALVDRPNVYVKIPATEQGLPAITAAISEGISVNVTLIFSLDRYRAVAQA
YLDGLEKAQLAGLDLSRIASVASVFLSRIDAKIDPVLDEIGGDEAATLRGGAAIAGARLA
YEAFEEIFSSPRWADLSSAGARVQRPLWASTGVKDPSYPDTRYVDELIAPHVVNTMPEKT
LQAVADHARLPDGDGPVDTVHGTAVAAREHLDAVVRLGVPYERLLTELEEEGVEKFVASQ
NELLGTVQSELDKAASRTNGATA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgaacgaccgactcgagcggatcagcgcctcgggcgtctcgatctggctcgac
gacctctcccgggaccggctcgacaccggtgagctcgcggagctcgtgagcacgagccac
gtcgtgggggtgacgacgaacccgacgatcttcgccgcagcgctgcaggacggcgacgcg
tacgccgaccaggtcggcgacctcgccgcccgcgggatcggcgcggaggaggcggcgatc
gcgctcacgagcgacgacgtgcgctcggccacggccgtgctcgcccccctctacaccgcg
tccgggttccaggacgggcgcgtgtcgatcgaggtcgacccacgtctggcccgcgacacg
gaggagacgatcgcccaggctcggcggctgtgggccctcgtcgaccgcccgaacgtgtac
gtgaagatcccggccaccgagcagggcctccccgcgatcactgcggccatctccgagggg
atcagcgtcaacgtgacgctgatcttctcgctcgaccgctaccgcgccgtcgcgcaggcc
tacctcgacggtctcgagaaggcgcagctcgccgggctcgacctgtctcggatcgcctcg
gtggcctcggtgttcctgtcgaggatcgacgccaagatcgacccggtgctcgacgagatc
ggcggggacgaggccgccacgctccgcggcggtgccgcgatcgccggcgcgcggctcgcg
tacgaggcgttcgaggagatcttctcgtcgccgcgctgggccgacctctcctcggccggg
gcacgcgtgcagcgtccgctctgggcgtcgacgggggtcaaggacccctcctacccggac
acccggtacgtcgacgagctgatcgccccgcacgtcgtcaacacgatgccggagaagacg
ctgcaggcggtggcggatcacgcgcggctgcccgacggcgacggcccggtcgacaccgtg
cacgggacggcggtcgcggcgcgcgagcacctcgacgccgtcgtccggctcggcgtgccg
tacgagcggttgctcaccgagctcgaggaggaaggcgtcgagaagttcgtcgccagccag
aacgagctgctcggcacggtgcagagcgagctcgacaaggccgcctctcgcaccaacggg
gccacggcgtga

DBGET integrated database retrieval system