KEGG   Beutenbergia cavernae: Bcav_2219Help
Entry
Bcav_2219         CDS       T00893                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00260  Glycine, serine and threonine metabolism
bcv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01130  Biosynthesis of antibiotics
bcv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcav_2219
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcav_2219
Enzymes [BR:bcv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcav_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB
Motif
Other DBs
NCBI-ProteinID: ACQ80470
UniProt: C5BV83
Position
complement(2500232..2501041)
Genome map
AA seq 269 aa AA seqDB search
MSTRVSARVGARIDEVRAEGRAALVGYLPLGYPTLDASVDAVRAMVGAGVDIVELGLPYT
DPVIDGPVVADAVDAALRAGVRVRDLFGAVEAIADTGAQVLVMTYWNPVLHYGVEAFAAD
LAAAGGAGLITPDLIPDEADEWIAASDAHDLDRVFLVAPSSSTERLAITAAASRGFVYAA
STMGITGTRARVGERAEQLVADTRAAGAERVCVGLGVSNGAQAAEIAAYADGVIVGSALV
RALDGVDPADPDLTRLTDLTRELAAGVRA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcgcgtgtcggcccgcgtcggggcacggatcgacgaggtgcgcgccgagggg
cgtgcggcgctcgtcgggtacctgccgctgggctacccgactctcgacgcgtccgtggac
gccgtccgggccatggtgggagccggcgtcgacatcgtcgagctcggcctgccgtacacg
gatccggtgatcgacggcccggtcgtggccgacgccgtcgacgctgctctgcgcgccggc
gtgcgggtgcgcgacctgttcggcgctgtcgaggcgatcgccgacaccggggctcaggtg
ctggtcatgacgtactggaacccggtgctgcactacggcgtcgaggccttcgccgcggat
ctcgcggccgccgggggagccgggctcatcacgccggacctcatcccggacgaggcggac
gagtggatcgccgcgtccgacgcccatgacctggaccgcgtcttcctcgtggcgccgagc
tcgtccaccgaacgcctggcgatcacggcggccgcgagccgtggcttcgtgtacgccgcg
tcgacgatggggatcaccgggacccgcgcgagggtgggggagcgcgccgagcagctcgtc
gccgacacgcgcgcagccggagccgaacgcgtgtgcgtcgggctcggcgtgtccaacggg
gcgcaggccgccgagatcgccgcctacgccgacggcgtcatcgtcggctccgcgctcgtc
cgggcgctcgacggtgtcgatcctgccgaccccgacctcacccggttgaccgacctcact
cgcgagctcgccgcgggggtgcgcgcatga

DBGET integrated database retrieval system