KEGG   Beutenbergia cavernae: Bcav_2220Help
Entry
Bcav_2220         CDS       T00893                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bcv  Beutenbergia cavernae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcav_2220
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcav_2220
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcav_2220
Enzymes [BR:bcv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcav_2220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2501038..2502333)
Genome map
AA seq 431 aa AA seqDB search
MPEAGTDRLENVTGPYFGAFGGRFVPEALIAALDELSTAYDKARTDPTFEAELTRLHREY
TGRPSPLTEVPRFAEHVTGTPGEARIFLKREDLNHTGSHKINNVLGQALLVKRMGKTRVI
AETGAGQHGVATATAAALMGLECVVYMGEEDTRRQALNVARMRILGAEVVPVTHGTRTLK
DAINEALRDWVTNVDSTHYLLGTVTGPHPFPEMVRDFHRIIGAEAREQILERVGRLPDAI
AACVGGGSNAMGIFNAFLDDDGVALFGFEAGGAGVSSGRHAARFSGGSPGVLHGARSYLL
QDDDGQTLPSHSVSAGLDYPSVGPEHAWLHDIGRATYEPVTDDEAMEAFLLLSRTEGIIP
ALESAHALAGALRVGRRLAEARPAGAEAPVLLVNLSGRGDKDMDTAARWFGLLDENGSGA
GGSADAEEGER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggccggtaccgatcggctggagaacgtcaccggcccgtacttcggtgcgttc
ggcgggcggttcgtcccggaggcgctgatcgcggcgctcgacgagctgtcgacggcgtac
gacaaggcacgcaccgacccgacgttcgaggcggagctcacgcgcctccaccgggagtac
acgggccgtccctccccgctgacggaggtgccccggttcgccgagcacgtcacgggcacg
ccgggcgaggcccggatcttcctcaagcgcgaggacctcaaccacacggggtcccacaag
atcaacaacgtgctgggccaggcgctgctcgtgaagcggatgggcaagacgcgcgtgatc
gcggagaccggcgcgggccagcacggggtggcgacggcgacagccgcggcgctgatgggg
ctcgagtgcgtcgtgtacatgggcgaggaggacacccggcggcaggctctcaacgtcgcc
cggatgcggatcctcggggccgaggtggttccggtcacgcacggcacgcgcacgctcaag
gacgcgatcaacgaggcgctgcgcgactgggtgacgaacgtcgacagcacgcactacctg
ctcggcaccgtcaccgggccgcacccgttcccggagatggtgcgcgacttccacaggatc
atcggtgcggaagcacgcgagcagatcctcgagcgcgtgggccgcctgccggacgcgatc
gccgcgtgcgtgggcggcgggtcgaacgccatggggatcttcaacgcgttcctggacgac
gacggcgtggcgctgttcgggttcgaggccggcggtgcgggggtctcgtcgggccggcac
gccgcgcgcttcagcggtgggtcgccgggcgtgctccacggcgcacgctcgtacctcctc
caggacgacgacggccagaccctgcccagccactccgtctcggccggcctggactacccg
agcgtcgggccggagcacgcgtggctgcacgacatcggtcgagcgacgtacgagcccgtc
accgacgacgaggcgatggaggcgttcctcctgctcagccgcaccgagggcatcatccct
gccctcgagagcgcgcatgcgctcgctggcgcgctgcgcgtgggccggcggctcgcggag
gctcgtcccgccggtgccgaggcacccgtgctcctcgtcaacctctcggggcgcggggac
aaggacatggacacagctgcccggtggttcgggctgctggacgagaacgggtcaggagcc
ggcggctccgccgacgccgaggagggcgagcgatga

DBGET integrated database retrieval system