KEGG   Beutenbergia cavernae: Bcav_2500Help
Entry
Bcav_2500         CDS       T00893                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00900  Terpenoid backbone biosynthesis
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01130  Biosynthesis of antibiotics
Module
bcv_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcav_2500
Enzymes [BR:bcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Bcav_2500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C
Motif
Other DBs
NCBI-ProteinID: ACQ80750
UniProt: C5BWT4
Position
complement(2794365..2795549)
Genome map
AA seq 394 aa AA seqDB search
MSARTVVLLGSTGSIGTQALDVVAAAPGRFQVVGLAAGGSDLELLARQAVAHDVPVVAVA
AGEQDDVAAAIRAAGGRRTEVLTGPGAAADLAGRGADVVLNGITGSVGLAPTLAALEAGS
TLALANKESLVAGAALVRAAQQRADQIVPVDSEHSAIAQALRSGARSEVARLVLTASGGP
FRGWSREQMAGVTPEQALAHPTWAMGPVVTTNSATLMNKGLELIEAHVLFDVPVADITVV
VHPQSVVHSMVEFVDGSTIAQASPPDMRLPIALGLAWPDRVPGAASPCRWDAATSWTFEP
VDDAAFPALDLAREAVKASPLHPAVLNAANEEAVAAFLDGRLPFLDVVGTVARVLGEYPD
PPDGALSLEGVQAAEAWARARSRALVADGPSRER
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgcgcaccgtcgtcctcctcggttccaccggttcgatcgggacccaggcgctc
gacgtcgtcgcggcggcgccaggacggttccaggtggtggggctcgccgccggcgggagc
gacctggagctgctcgcgcggcaggcggtcgctcacgacgtgccggtcgtcgccgtcgcc
gccggcgagcaggacgacgtcgccgcggcgatccgcgcggccggcggccgccggacggag
gtcctcaccggcccgggagccgccgccgacctcgccgggcgcggcgccgacgtcgtgctc
aacgggatcacggggtccgtcgggctcgcgccgacgctcgcggcgctcgaggcgggttcg
acgctcgcgctcgcgaacaaggagtcgctcgtggcgggcgccgcgctggtgcgggccgcc
cagcagcgcgccgaccagatcgtgccggtcgactcggagcactcggccatcgcgcaggcg
ctgcggtccggagcgcggtccgaggtcgcgcggctcgtgctcacggcctcgggtgggccg
ttccgcggctggtcgcgcgagcagatggccggcgtgacgcccgagcaggcgctggctcac
cccacctgggcgatggggccggtcgtcaccacgaactccgcgacgctcatgaacaagggc
ctcgagctcatcgaggcgcacgtcctgttcgacgtgccggtcgcggacatcaccgtcgtc
gtgcacccgcagtcggtcgtccactcgatggtcgagttcgtggacgggtcgacgatcgcc
caggcatccccaccggacatgcggctgccgatcgcgctcggcctcgcctggcccgaccgg
gtgcccggtgcggcgtcgccgtgccgctgggacgccgcgacgtcgtggacgttcgagccg
gtcgacgacgccgcgttcccggctctcgacctcgcgcgtgaggcggtgaaggcgtcgccg
ctgcacccggccgtgctcaatgccgcgaacgaggaggcggtcgcggcgttcctcgacggg
cgcctgccgttcctcgacgtcgtcgggactgtcgcccgcgtgctgggggagtacccggat
ccgcccgacggcgcgctgtcgctcgagggcgtccaggccgcggaggcgtgggcacgagcg
cggtcgcgggcgctcgtcgccgacggaccctcgcgggagcgctga

DBGET integrated database retrieval system