KEGG   Beutenbergia cavernae: Bcav_2796Help
Entry
Bcav_2796         CDS       T00893                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bcv  Beutenbergia cavernae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcav_2796
Enzymes [BR:bcv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Bcav_2796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3116014..3117159)
Genome map
AA seq 381 aa AA seqDB search
MSAEVEPGSAGRELTQVMAGCTVLVTADRRSSELAAALERRGAEVRHAPALGMIPHVDDS
RLLDATRALLEDAPDVVVVTTGIGFRAWVEAADAHGLADDLVQVLAGARLVARGPKARGA
IQAVGLTADWVAESETSAEVADLLLGEGVVGLRIAVQHHGAGADGLDVVLAEARAQVISL
EVYRWGPAPDPEAVRVSVHAAADGEIDAVVFTSAPGAEAWLGAAEAEGVGAEVVARLASG
AMVAAAVGPITAKPLERRGVRPLQPDRGRLGALVRTLIAHYEQAETYALCTTAGRLLIRS
RVAVLDGRVLGLSPSGLEVLRTLAAAHGDVVSRDAVLEALPGESRDPHAAEVAIARLRES
TGAPGLVRTVVKRGYRLELAG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcggaggtcgagccggggagcgccgggcgcgagctcacgcaggtgatggccggg
tgcacggtgctggtgacggcggaccggcgctcctcggagctggcggcggcgctcgagcgg
cgcggcgcggaggttcggcatgcgccggcgctcgggatgatcccgcacgtcgacgactcc
cggctgctcgatgccacgcgcgcgctcctcgaggacgcgccggacgtcgtcgtcgtcacc
accgggatcgggttccgggcctgggtcgaggcggctgacgcgcacgggctcgcggacgac
ctcgtgcaggtcctcgccggggcgcggctcgtggcgcgtggaccgaaggcgcgtggggcg
atccaggcggtggggctgacggcggactgggtggccgagtcggagacgtcggccgaggtg
gcggacctgctcctcggcgagggcgtggtcgggctgcggatcgccgtccagcaccacggt
gccggggcggacgggctcgacgtcgtgctcgccgaggcacgcgcccaggtgatcagcctc
gaggtgtaccggtgggggccggcgccggacccggaggcggtgcgggtctcggtgcacgcg
gcggcggacggggagatcgacgccgtcgtgttcacgtcggcgcccggcgcggaggcgtgg
ctcggcgcggcggaggccgagggcgtgggtgcggaggtggtcgcgcggctggcgtcgggc
gccatggtggcggcggcggtcggtccgatcacggcgaagccgctcgagcgccgcggcgtg
aggccgttgcagccggaccgcgggcggctcggagcgctcgtgcggacgctgatcgcccac
tacgagcaggcggagacgtacgccctgtgcacgaccgccgggcgactcctcatccgctct
cgggtcgcggtgctggacgggcgcgtgctcggactctcgcccagcgggctcgaggtgctc
cggaccctcgcggccgcgcacggcgacgtcgtctcgcgggacgcggtgctcgaggcgctg
cccggcgagtcgcgcgacccgcacgcggccgaggtcgcgatcgcccggctgcgggagtcg
accggggcgccggggctcgtgcgcaccgtcgtgaagcggggctaccggttggagctggcg
ggatga

DBGET integrated database retrieval system