KEGG   Beutenbergia cavernae: Bcav_2816Help
Entry
Bcav_2816         CDS       T00893                                 

Definition
glycoside hydrolase family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bcv  Beutenbergia cavernae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bcav_2816
  Lipid metabolism
   00561 Glycerolipid metabolism
    Bcav_2816
   00600 Sphingolipid metabolism
    Bcav_2816
Enzymes [BR:bcv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Bcav_2816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3141364..3143544
Genome map
AA seq 726 aa AA seqDB search
MSRVVSHPAPSDVPDAVQLSAGGTGVVLDLAGGRLPRVLHWGRDVGRLPPTEIDDLRRAS
VPPQVSGWVDVDVPLGLLPEQSAGWLGTPGLTGHRAGRDFSTAFVTTAVDVTEPADDPTI
AHRVRVSARDAVADLDLELDLELTRSGVLRLRARVTNTGDDVFDLATLDLALPVPTEAAE
LLDLTGRHLRERSMQRGPFTLGTHLRESRRAAGHDASLVLAAGEPGFGWRHGDVWGVHVA
WSGNTRTYAERTNHGESFLAGGELLLAGEVRLHRGERYETPWLYASRGTGLDDLAARFHD
FLRARPEHPRSPRPVTLNVWEAVYFDHDLPRLLELARIAADVGVERYVLDDGWFRHRRND
SAGLGDWYVDEGVWPDGLAPIVDAVHELGMQFGLWFEPEMINPDSDLARAHPEWIMAPGD
RLPVPARRQQVLNLSIPEAYEHVRSRMLAILDEYRIDYIKWDHNRPLVEAATRATGQPAV
HAQTLATYRLIDELKAAHPGLEIESCSGGGGRADLGILARTDRIWASDCIDPLERQQIEA
GTSLLLPPELVGSHVASPVSHTTGRSHSLDFRAGTAFFSHLGIEWDVTKADDADRARLAA
WVATHQAHRHLLHTGRVVHADQPNPALWVHGVVAADAAEAIFAVVALATGVASPPGRVRI
PGLAPDARYRVAPLPPGDYDDPRVRWHQPSWWADGVTLAGVVLAEVGIQVPALLPEQQAL
LHLERV
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgcgtcgtgtcccaccccgccccgtccgacgttcccgacgccgtccagctcagc
gcaggcggcaccggcgtcgtcctcgacctcgccggaggccggctgccgcgggtgctgcac
tggggccgcgacgtcggccggctcccccccacggagatcgacgacctgcgccgcgcgagc
gtcccgccccaggtctccggctgggtcgacgtcgacgtcccgctcgggctgctgcccgag
cagagcgccggctggctcggcacccccggactcaccggtcaccgcgcgggccgcgacttc
tcgacggcgttcgtcaccaccgccgtcgacgtcaccgagcccgcggacgaccccacgatc
gcccaccgcgtccgcgtgagcgcccgggacgccgtcgccgatctcgacctcgagctcgac
ctcgagctgacccggtcgggcgtgctgcgcctccgtgctcgggtgacgaacaccggcgac
gacgtcttcgacctcgccacgctcgacctcgcgctgccggtgccgaccgaggcggcggag
ctgctcgacctcacaggccggcacctgcgggaacgctcgatgcagcgcggcccgttcacg
ctcgggacgcacctgcgggagtcgcggcgcgccgccggccacgacgccagcctcgtgctg
gccgccggcgagccgggcttcgggtggcggcacggcgatgtgtggggcgtgcacgtcgcg
tggtcgggcaacacccgcacctacgcggagcgcacgaaccacggcgagtcgttcctcgcc
ggcggcgagctcctcctcgcgggcgaggtgcggctgcaccgcggcgagcggtacgagaca
ccgtggctgtacgcctcacgcggcaccggcctcgacgacctggcggcgcgcttccacgac
ttcctgcgcgcccggcccgagcacccccgctcgccgcggccggtcacgctcaacgtctgg
gaggcggtctacttcgaccacgacctgccccggctcctcgagctcgcccggatcgccgcc
gacgtgggcgtcgagcggtacgtgctcgacgacggctggttccgccaccgccgcaacgac
tccgccggcctgggcgactggtacgtcgacgagggcgtgtggccggacggcctcgcgccg
atcgtcgacgccgtgcacgagctggggatgcagttcggcctgtggttcgagcccgagatg
atcaaccccgactcggacctcgcccgcgcccaccccgagtggatcatggctccgggcgac
cgcctgccggtgccggcgcggcggcagcaggtcctcaacctctcgatccccgaggcgtac
gagcacgtccggtcgaggatgctcgcgatcctcgacgagtaccggatcgactacatcaag
tgggaccacaaccgcccgctcgtcgaagcggcgacccgcgccaccgggcagccagccgtg
cacgcccagacgctcgccacgtaccggctcatcgacgagctcaaggcggcccaccccggc
ctggagatcgagtcgtgctccggcggcggcgggcgggccgacctcgggatcctcgcgcgc
accgaccggatctgggcgtccgactgcatcgatccgctcgagcggcagcagatcgaggcg
ggaacgtccctgctcctcccgcccgagctcgtgggctcgcacgtcgcctccccggtcagc
cacacgaccggccggtcgcactccctcgacttccgcgccgggacggcgttcttctcccac
ctcggcatcgagtgggacgtgacgaaggccgacgacgccgaccgcgctcgcctcgccgcg
tgggtcgccacgcaccaggcccaccggcacctcctgcacaccggccgcgtcgtccacgcg
gaccagccgaacccggcgctgtgggtgcacggcgtcgtcgccgcggacgccgccgaggcg
atcttcgccgtcgtcgccctcgccaccggtgtcgcgtccccgcccggccgggtccggatc
cccggtctcgcgcccgatgcgcggtaccgcgtcgccccgctgccgccgggcgactacgac
gacccccgggtgcggtggcaccagccgtcctggtgggccgacggcgtcacgctggccggc
gtcgtcctcgccgaggtcgggatccaggtacccgccctccttcccgagcagcaggcgctg
ctccacctcgaacgggtctga

DBGET integrated database retrieval system