KEGG   Beutenbergia cavernae: Bcav_2865Help
Entry
Bcav_2865         CDS       T00893                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bcv  Beutenbergia cavernae
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bcav_2865
   00670 One carbon pool by folate
    Bcav_2865
Enzymes [BR:bcv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Bcav_2865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3199241..3199750
Genome map
AA seq 169 aa AA seqDB search
MIGMIWAQAHDGVIGARGTVPWHVPEDFAHFKATTRGHAVVMGRATWDSLPDRYRPMPER
RNVVVTRQVDWSADGAERAGSIPDALERCAAEPETWIMGGAQIYAEAMPYADTLVVTQLD
LALDVEGAPDVVHAPPIGPEWRIATDTWDGTWQTSRTGVRWQVHQYVRA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggatgatctgggcgcaggcccacgacggggtgatcggcgcccgcggcacggtg
ccgtggcacgtgcccgaggacttcgcgcacttcaaggcgacgacgcgcggccacgccgtc
gtcatgggccgcgccacgtgggactcgctgcccgaccgctaccggcccatgcccgagcgg
cgcaacgtcgtcgtcacgcggcaggtggactggtcggccgacggcgccgagcgggccggg
tcgatcccggacgccctcgagcggtgcgcagccgagccggagacgtggatcatgggcggc
gcccagatctacgccgaggcgatgccctacgccgacacgctcgtggtcacgcagctcgac
ctggccctcgacgtcgagggcgcaccggacgtcgtccacgcgccgccgatcggcccggag
tggcggatcgcgacggacacgtgggacgggacgtggcagacgtcgcggacgggcgtgcgc
tggcaggtccaccagtacgtgcgggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system